KEGG   Alligator sinensis (Chinese alligator): 102368909Help
Entry
102368909         CDS       T02922                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102368909 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102368909 (LPL)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102368909 (LPL)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102368909 (LPL)
  Exosomal proteins of breast milk
   102368909 (LPL)
Glycosaminoglycan binding proteins [BR:asn00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102368909 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:asn00537]
 Enzymes
  102368909 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 504 aa AA seqDB search
MTPEQLKRAWPERCNVQVRPLVSQSSGSGCIRLREGGSCDTRTTPETRGIFEGIESKFSL
RTPAIPDEDICYLVPGQKDSLAHCSFNHTSKTFLVIHGWTVTGMYESWVPKLVDALYKRE
PDSNVIIVDWLTRAQQHYPVSAAYTKLVGKDVASFIDWMEEQFNYPFENVHLLGYSLGAH
VAGIAGSLTKKKINRITGLDPAGPTFEYADAPMRLSPDDAEFVDVLHTYTRGSPDRSIGI
QQPVGHIDIYPNGGGFQPGCNLGEALRLIAEKGFGDVDQLVKCSHERSIHLFIDSLMYEE
KPSMAYRCQTKEAFEKGLCLSCRKNRCNKMGYQVHKVRTKRNSKMYLKTRSQAPYKVFHY
QVKIHFFGKENVTKTSQPLLISLYGTTDERKNIAFILPEISTNKTYSFLVYTEVDIGDLL
RLSLQWERDSFFSWTEWWTSFTFDIHRVRVKAGETQKKMVFCSQDGAAHLQKGGEAVMFV
KCLGNPVRRRKAGHKPISEIKTDP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggagcagttaaaacgggcctggcccgagcgctgcaacgtgcaggttcggcct
ctggtttcccagtcctcgggttccggatgtattcggcttcgtgaaggcggtagctgcgac
acaagaactaccccagaaacgaggggaatctttgaggggattgagagcaaattttcttta
aggacacctgctatacctgatgaggacatttgctacttggtacctggccaaaaggactca
ctggcacactgcagctttaaccacaccagcaaaaccttcctggtgatccatggatggacg
gtaactgggatgtatgagagctgggtgccaaaactggtggatgctctgtataaaagagag
cctgactctaatgtcattattgtagattggctaactagagcccagcaacactatccagta
tctgctgcatacactaaactggtgggaaaggacgtggcctcttttattgactggatggag
gagcaatttaactacccttttgaaaatgtccatttgctggggtacagtctgggagcacat
gtagctgggattgctggaagtctgaccaaaaagaagattaacagaattactggtttggat
ccagctggtcctacctttgaatatgctgatgcacctatgcgcctatccccagatgatgct
gaatttgttgatgtcctacacacttacacaagggggtccccagaccggagcattgggata
cagcagccagttgggcatattgatatctatcctaatggaggaggcttccagccaggctgt
aacctaggagaagctctgcgcctcattgcagaaaaaggctttggagatgtggatcagctc
gtgaaatgctctcatgaacgttccatccatctcttcattgactctctaatgtatgaggaa
aagccaagcatggcctatcgttgtcaaacaaaggaagcctttgaaaaggggctttgttta
agctgcaggaagaaccgctgcaacaaaatgggttatcaggtccataaagtgagaaccaag
agaaacagtaagatgtatctgaagacacggtctcaggcaccctataaagtttttcattac
caggtcaagatccatttttttggaaaggagaatgtaactaagacaagtcagccattgctc
atttctctgtatggcacaacggatgagagaaagaacattgcctttatactacctgaaatt
tccacaaacaagacctactcctttctggtttacacagaggtggatattggtgacttactt
aggctgagtctgcagtgggagagagactcttttttcagttggacagaatggtggacctcc
ttcacatttgacatccacagagtgcgagtgaaggctggagaaacccagaaaaagatggtg
ttctgttctcaggatggagctgctcacctccaaaagggaggggaagctgtaatgtttgtg
aaatgccttggtaaccctgtccgcagaaggaaagcaggacacaagccaatttctgaaatt
aaaactgacccatga

DBGET integrated database retrieval system