KEGG   Alligator sinensis (Chinese alligator): 102368909Help
Entry
102368909         CDS       T02922                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102368909
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102368909
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102368909
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102368909
  Exosomal proteins of breast milk
   102368909
Heparan sulfate/heparin binding proteins [BR:asn00536]
 Enzymes (General comment) Variety
  102368909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 661 aa AA seqDB search
MVVLNMDLEKAYDRVSHWFLFETLQQMGVPPTFTSWVRTLYTDVSTEVLVNGFLSERTAI
ELGVHQGCLLSMILFICTIKPLGQRIRQDSRMHRVQIPRGSTEQAKVLAYMDNLNILCRN
KSAVERTLWHTWIYKVAEGAKLNVSKSTWLAVGELRDLETLGVLVPHKRVKILGVEFDLE
LSGRRAWEKKKAKVKQRLRTTPETRGIFEGIESKFSLRTPAIPDEDICYLVPGQKDSLAH
CSFNHTSKTFLVIHGWTVTGMYESWVPKLVDALYKREPDSNVIIVDWLTRAQQHYPVSAA
YTKLVGKDVASFIDWMEEQFNYPFENVHLLGYSLGAHVAGIAGSLTKKKINRITGLDPAG
PTFEYADAPMRLSPDDAEFVDVLHTYTRGSPDRSIGIQQPVGHIDIYPNGGGFQPGCNLG
EALRLIAEKGFGDVDQLVKCSHERSIHLFIDSLMYEEKPSMAYRCQTKEAFEKGLCLSCR
KNRCNKMGYQVHKVRTKRNSKMYLKTRSQAPYKVFHYQVKIHFFGKENVTKTSQPLLISL
YGTTDERKNIAFILPEISTNKTYSFLVYTEVDIGDLLRLSLQWERDSFFSWTEWWTSFTF
DIHRVRVKAGETQKKMVFCSQDGAAHLQKGGEAVMFVKCLGNPVRRRKAGHKPISEIKTD
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgctgaacatggacctggaaaaagcctacgacagagtgtcacactggtttctc
tttgagaccctgcagcagatgggcgtccctccgactttcaccagctgggtaaggactctg
tacacagatgtaagcaccgaggtgctggtaaatggtttcttgagtgagcggactgcaata
gagttgggggtccatcagggctgcctcctctccatgatccttttcatctgcaccatcaaa
cccctgggtcagcgcatcaggcaggactccaggatgcacagagtccagatccccagagga
agtacggaacaggccaaggtcctggcctacatggacaatttgaacatcctgtgtaggaat
aagagtgcagtagaaagaactctgtggcacacatggatttacaaagtggcagagggggcc
aagctcaatgtgagcaaaagcacctggctggctgtgggtgagcttagagacctggagacc
ctgggggtcttggttccccacaagagggtcaagatccttggggtggaatttgacctggag
ctgagtggaagaagggcctgggagaagaagaaggccaaggtgaagcagaggttgagaact
accccagaaacgaggggaatctttgaggggattgagagcaaattttctttaaggacacct
gctatacctgatgaggacatttgctacttggtacctggccaaaaggactcactggcacac
tgcagctttaaccacaccagcaaaaccttcctggtgatccatggatggacggtaactggg
atgtatgagagctgggtgccaaaactggtggatgctctgtataaaagagagcctgactct
aatgtcattattgtagattggctaactagagcccagcaacactatccagtatctgctgca
tacactaaactggtgggaaaggacgtggcctcttttattgactggatggaggagcaattt
aactacccttttgaaaatgtccatttgctggggtacagtctgggagcacatgtagctggg
attgctggaagtctgaccaaaaagaagattaacagaattactggtttggatccagctggt
cctacctttgaatatgctgatgcacctatgcgcctatccccagatgatgctgaatttgtt
gatgtcctacacacttacacaagggggtccccagaccggagcattgggatacagcagcca
gttgggcatattgatatctatcctaatggaggaggcttccagccaggctgtaacctagga
gaagctctgcgcctcattgcagaaaaaggctttggagatgtggatcagctcgtgaaatgc
tctcatgaacgttccatccatctcttcattgactctctaatgtatgaggaaaagccaagc
atggcctatcgttgtcaaacaaaggaagcctttgaaaaggggctttgtttaagctgcagg
aagaaccgctgcaacaaaatgggttatcaggtccataaagtgagaaccaagagaaacagt
aagatgtatctgaagacacggtctcaggcaccctataaagtttttcattaccaggtcaag
atccatttttttggaaaggagaatgtaactaagacaagtcagccattgctcatttctctg
tatggcacaacggatgagagaaagaacattgcctttatactacctgaaatttccacaaac
aagacctactcctttctggtttacacagaggtggatattggtgacttacttaggctgagt
ctgcagtgggagagagactcttttttcagttggacagaatggtggacctccttcacattt
gacatccacagagtgcgagtgaaggctggagaaacccagaaaaagatggtgttctgttct
caggatggagctgctcacctccaaaagggaggggaagctgtaatgtttgtgaaatgcctt
ggtaaccctgtccgcagaaggaaagcaggacacaagccaatttctgaaattaaaactgac
ccatga

DBGET integrated database retrieval system