KEGG   Alligator sinensis (Chinese alligator): 102369056Help
Entry
102369056         CDS       T02922                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102369056
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102369056
Glycosyltransferases [BR:asn01003]
 Glycan extension
  Type 3 chain
   102369056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 364 aa AA seqDB search
MASPKSLLSLVTFTFGSAIGFFLCYVLFSIVLEEQVEIHPHVLHNDPHGEHIEETGNNQL
EGQMNFNADAGQHKDENKLIADDLYQKVKILCWVMTGPQNLEKKAKHVKATWAQHCNKIL
FMSSEENKDFPTVGLEAKEGRDQLYWKTIKAFQYVHDHYFDDADWFMKADDDTYVILDNL
RWLLSKYSPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVNAFKTNKCSHSSSIE
DLALGKCMETINVEAGDSRDTSGKETFHPFVPEHLLIRGYLPKTFWYWNYNYYPAVEGPG
CCSDLAVSFHYVDPTTMYQLEYLIHHLRPYGYLYRYNPDSPKSLEKQSKSEAKDSDAKDK
AENP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcctaaatctttgctgagtctcgtaaccttcacttttgggtcagcaatagga
tttttcttatgctatgtgctatttagtatagtgctagaagaacaagttgagatccatcct
catgttcttcacaatgatcctcacggtgagcacatagaagaaactggaaataatcagctg
gagggacaaatgaacttcaatgcagatgctgggcagcataaagatgaaaacaaacttatt
gctgatgacttgtatcagaaggtcaaaatactctgttgggtcatgactgggcctcagaat
ctagagaagaaagccaaacatgttaaagccacttgggcacagcattgcaataaaatatta
tttatgagctctgaggagaataaagattttccaaccgtgggcctagaagccaaagaaggc
agggaccaattgtattggaaaactattaaagctttccagtatgtacatgatcattatttt
gatgatgctgactggtttatgaaagcagatgatgatacatatgtcatattggataatttg
aggtggcttctttcaaaatacagtccagaacaaccaatatactttggaagaaggttcaag
ccttatgtgaaacagggctacatgagtggaggagcaggatatgtactgagcaaagaagct
ctaaagagatttgttaatgcatttaaaaccaacaaatgttctcatagctcttctattgaa
gaccttgcacttggaaaatgcatggagactattaacgtagaagctggagattcaagggac
acaagtggtaaagaaacttttcatccctttgtgccagaacatctcttaatccgaggatac
ctaccaaagacattttggtattggaattataattattatcctgctgtggagggtcctggt
tgctgctcagatctggcagtttcattccactatgttgatcccacaactatgtatcaattg
gaatatctgattcatcatctccgtccatatggttacctctatcggtataaccccgactct
cccaagagcctagaaaaacaaagcaagagtgaagcaaaggatagcgatgcaaaagataaa
gcggaaaacccctga

DBGET integrated database retrieval system