KEGG   Alligator sinensis (Chinese alligator): 102369090Help
Entry
102369090         CDS       T02922                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102369090 (MAOA)
   00330 Arginine and proline metabolism
    102369090 (MAOA)
   00340 Histidine metabolism
    102369090 (MAOA)
   00350 Tyrosine metabolism
    102369090 (MAOA)
   00360 Phenylalanine metabolism
    102369090 (MAOA)
   00380 Tryptophan metabolism
    102369090 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102369090 (MAOA)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102369090 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 502 aa AA seqDB search
MSAAKLLSDSGLSVVVLEARDRVGGRTFTIRNKQVNYVDVGGAYVGPTQNRILRLAKELG
IETYKVNIEERVIYHVKGKSYPLYGLFPTVWNPLVYLDYNNLWRKMDEMGKEIPAEAPWD
APHAAEWDKMTMKELISKICWTKAARDFATLFVNVNVTSEPHEVSALWFLWYVKQCGGTT
RIFSVTNGGQERKFVGGSGQITEKIMQRLGGRVKLERPVVHIDQSGENVIVQTLNHEKYE
GKYVISAIPPGLTTKIHFNPELPTKRNQLIQRLPMGSVIKCMVYYKEAFWRKMDYCGSMV
IEDEEAPISITLDDTKPDGSVPAIMGFILTRKAFKLVHLSKEERKKKICELYAKVLGSEE
ALHPVHYEEKNWSAEQYSGGCYTVYFPPGIMTQYGRIIRESFGRIYFAGTETATQWSGYM
EGAVQAGERAAREILCKMGKISESEIWKSEPESKDVPALPITTTFWERNLPSLPGLLMLV
GVFTPMAALGLFAYKKGLLFRN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagccaaactactgtctgactctggccttagtgttgtggttctggaggcccgt
gacagagttggaggaaggaccttcactattaggaacaagcaagtaaattatgtagatgtt
ggtggtgcatatgtaggacctacccaaaaccgcatccttcggctggccaaggagctgggc
atagaaacatacaaagtgaatatagaagagagggtaatctaccatgtgaagggaaagtcc
tatccactctatggtctgtttcccacagtttggaatcccttggtttacttggattataac
aatctatggaggaaaatggatgaaatgggcaaagagatccctgctgaagcaccatgggat
gctccacatgctgcagagtgggacaagatgacaatgaaagagctcatcagcaaaatttgc
tggactaaagctgccagagactttgctactctctttgtgaacgtcaatgtcacttctgag
ccacacgaggtctctgctctctggttcctgtggtacgtgaagcagtgtgggggaacaacc
aggatattttccgtaaccaatgggggccaggagcggaagtttgttggaggctctggtcag
attacagagaagataatgcaacgccttggaggaagagttaaactggagagacctgtagtc
cacattgatcagtcaggtgaaaatgtcattgtgcagacactaaaccatgagaaatatgag
ggcaagtatgtgatcagtgctattccccctggcctgactacaaagatccatttcaaccca
gaattaccaacaaagagaaaccagttaattcaacgtcttcctatgggctctgtcatcaaa
tgcatggtgtactacaaggaagccttctggagaaagatggattactgtggcagcatggtc
attgaggatgaagaagctccaatttcaataaccttagatgacactaaacctgatggatct
gtgcctgccattatgggttttatccttacaagaaaggcctttaagctggtgcatcttagc
aaggaagagaggaaaaagaaaatctgtgagctgtatgccaaagtgctgggttcagaagag
gctttacatccagtgcattatgaagagaagaactggagtgcagaacagtattcaggtggc
tgttatacagtctacttcccaccaggcataatgactcaatatggaaggatcattcgagag
tcatttggcaggatctactttgctggcacagagacagctacccagtggagcgggtacatg
gaaggagctgtgcaggctggggagagagcagcaagggagatactgtgcaagatgggaaag
atctcagagagtgaaatctggaagtctgaaccagagtcaaaggatgtcccagccctgcca
atcactactaccttttgggagaggaacctgccatctctaccaggactactgatgctagtt
ggagttttcacacccatggctgctcttgggctgtttgcttacaaaaaggggctgctattt
cgaaactga

DBGET integrated database retrieval system