KEGG   Alligator sinensis (Chinese alligator): 102369399Help
Entry
102369399         CDS       T02922                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102369399 (BAP1)
Peptidases [BR:asn01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102369399 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 720 aa AA seqDB search
MALPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDE
TSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTKGFSPESKG
YAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKV
YPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESKLHIL
KMNRQTVLEALQQLIRVTQPELIQTQKSQDSQPAEEAKPASSKTCLALETGRAPLAPESS
HPDSTDECTAQGHAASTQSPPNKSKLVAKPSVSSINGAPPPNPNPIVQRLPAFLDNHNYA
KSPMQEEEDLAAGVGRNRVPVRQPQQYSDDEDDYDDEEEEEVRNTNSAMRYKRKGLVKQD
HVGGAADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTGSGGAAVAVVTHSQPSPTPS
NESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEEDSLLRVDCMRYNRA
VRDLGPIISTGLLHLTEDGVFCPLAITDGGKGSLPSIKQSDEAHPAVKLEEREASEPSDS
KEKAGLSRPSDHVGGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTH
NYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccaggtctgttcaccctgttggtagaagattttggggttaaaggggtgcaa
gttgaggagatctatgatctacagagcaaatgccagggccctgtttatgggttcattttc
ctcttcaaatggattgaagagcgccggtctcgccggaaggtttccaccctagtagacgag
acatcagtgatcgatgatgacattgtcaataatatgttctttgcccaccagctgatcccc
aattcctgtgccacccacgccctactgagcgtgctcctgaactgcagcaatgtggacctg
gggcccacgctgagccgcatgaaggatttcaccaagggcttcagtccagagagtaaaggc
tatgccatcggcaatgccccagagctggccaaggcccataacagccatgccaggccagag
cctcgccatctgccggaaaagcagaatggaatcagtgctgtgcggaccatggaggctttc
cattttgttagctatgttcccattaaggggcggctctttgagctggatggcctgaaggtc
tatcccatagaccatgggccctgggctgaggatgaggagtggacagacaaagccaggaga
gtgatcatggagaggattggactagccacagcaggggagccataccatgatattcgcttc
aacctgatggcagtggtgcctgaccggaggatgaagtatgagtctaaactgcacatcctg
aagatgaacaggcagactgtcctggaggccttgcagcagcttatccgagtgacccagccg
gagctgattcagacccaaaagtcccaggattctcagcctgctgaggaggccaaaccagca
agcagcaagacctgtttggcactggagactggcagggcaccactagccccagagagctct
cacccagacagtactgatgagtgcacggcccagggccacgccgcatccacccagagcccc
cccaacaagtccaaactagtcgcaaagccttctgtgagcagcatcaatggggcgcctcca
ccgaaccctaaccccattgtgcagagactgccggccttcctggacaaccacaactatgcc
aagtcacccatgcaggaggaagaggaccttgctgcaggagtgggccgaaaccgcgtccct
gtccgacagccccagcagtactcggacgatgaggatgactatgatgatgaggaggaggag
gaagtccgtaacaccaactctgccatgaggtacaagaggaaggggctggtgaagcaggat
catgttgggggtgcagcagatggccagctctctgtcctccagcccaacaccataaacgtc
ttggcggagaagctcaaggagtctcaaaaggatctctccatccccctttccatcaagact
ggcagtgggggtgctgctgtggctgttgtcactcattcccagccctcccccacacccagc
aatgagagtacagacactgcctcagagatagggagtgccttcaactcaccactgcgttct
cctatccgctcagccaaccccacccggccctcaagccctgtcacctcccacatctccaag
gtgctctttggggaggaggacagcctgctgcgcgtggactgcatgcgttacaatcgggct
gtgagggacctgggtcccattatcagcacaggcctgctgcacctcactgaggacggggtg
ttctgcccattggccatcacagacggtggaaaaggttccctgccttctatcaaacagagc
gatgaggcccaccctgctgttaaactagaggagagggaagccagcgagcccagtgacagc
aaagagaaggctggactcagcaggccaagtgatcacgttggcggggaaaagtattctccc
aaagagctgctggcactgctgaagtgtgtggaagcagagattgccaactacgaggcttgt
ctgaaggaggaggtagagaagaggaaaaaattcaagattgatgaccagagaagaacccac
aactacgatgaattcatctgcaccttcatctctatgttggctcaggaagggatgctggcc
agccttgtggagcagaacatctctgtgcgtagacggcagggagtcagcattgggcgcctc
cacaagcagaggaaaccagaccgtcggaaacgctcccgtccttacaaagccaagcgccag
tag

DBGET integrated database retrieval system