KEGG   Alligator sinensis (Chinese alligator): 102369460Help
Entry
102369460         CDS       T02922                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102369460 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 422 aa AA seqDB search
MAGDILINARLTAMEKKLAEYKCNTNEAIQLKLVRFPEDLEDDNTAFNPEYSHQVFGDDE
VAFGYQGLKILLYYIAGNLSTXXXXXXXXXXIKYTSKVNEKFDCVEADDVESKIREIIPP
GFCTNMDDFVSLLEKEVNFKPFGTLLHTYSVHNVEAGEDITYQIYKADMTCPGFRDYHER
LQTFLMWFIETASFIDVDDERWNYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPR
VSQMLILPPFQGEGHGAQLLETVHRYYMSSPTVLDITAEDPSENYVKLRDFVLVKLCQNL
PCFSPEKLMQGFSQEMVTEAQQKLKINKQHTRRVYEILRLRATDMGDTEQSRSYRLDVKR
RLIGPYKKKQRELAKMRRCLRPEELTNQLNQIDLNMQHEQLEESFQQLVSDYRRVLERLA
QA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctggagacatccttataaatgctaggcttactgctatggagaagaaattggctgag
tacaaatgtaatacaaatgaagcaattcaactgaaattagttcgttttcctgaggatctg
gaagatgataacacagcatttaatccagagtacagtcatcaggtgtttggagatgatgaa
gttgcctttggttaccagggtttgaagatccttttgtactacatagctggtaacctgtca
acgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnatcaagtacacatctaaggttaatgaa
aagtttgactgtgtggaggcagatgatgtggaaagtaaaattagagaaatcattcctcct
gggttttgcacaaacatggatgactttgtgtctttgctggaaaaagaggtcaatttcaag
ccctttggaacattgcttcatacatactctgttcataatgtggaagcgggtgaggatata
acatatcagatatacaaggctgacatgacatgtccaggctttcgagactatcatgaaagg
cttcagacgttcttgatgtggtttattgaaactgctagctttattgacgtggatgatgaa
agatggaactactttctagtatttgagaagtataataaggatggagctacgctctttgcg
accgtaggctacatgacagtctataattactatgtgtatccagacaaaacccggccacgt
gtaagtcagatgctaatattgcctccattccaaggagaaggccatggtgctcagcttctt
gaaactgttcacagatactatatgtcttctcctacagtgcttgatataacagctgaagat
ccatctgaaaactatgtgaaactcagggactttgtacttgtgaagctgtgccaaaatctg
ccttgcttttccccagagaagttaatgcaagggttcagtcaagaaatggtgacagaggct
cagcaaaaactgaaaataaataagcaacatacaaggcgagtgtatgaaattctgcgattg
cgtgcaacagatatgggtgacacagagcaatctagaagttacaggttggatgtcaaaaga
agactgattggtccctataagaaaaaacagagagagctggctaagatgcgaagatgtctg
agaccagaggagttgacaaaccaattgaaccaaatagacctaaatatgcagcatgaacag
ttagaggagagcttccaacagcttgtttcagattaccgaagggtgctagaacgacttgct
caagcatga

DBGET integrated database retrieval system