KEGG   Alligator sinensis (Chinese alligator): 102370665Help
Entry
102370665         CDS       T02922                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102370665 (KAT2A)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102370665 (KAT2A)
Transcription machinery [BR:asn03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102370665 (KAT2A)
Chromosome [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102370665 (KAT2A)
   HAT complexes
    PCAF complex
     102370665 (KAT2A)
    STAGA complex
     102370665 (KAT2A)
    TFTC complex
     102370665 (KAT2A)
    SAGA complex
     102370665 (KAT2A)
    SLIK complex
     102370665 (KAT2A)
    ADA-HAT complex
     102370665 (KAT2A)
    HAT-A2 complex
     102370665 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 811 aa AA seqDB search
MDVAGFSPEELTVRLEGRRVTVTGRREKQSAGEDGGSFQEYLELRREMLLPAALDVEAVT
CSLCSDGQLRIEAPRLALQPAEGKAIPISIQAGEGATQGDTAAKEEKELGREHPVATLSE
PCRSCGHALADHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLL
RKCILQMSRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQTMYELSKMFLLCL
NYWKLETPSQFRQRSQNDDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLKSI
FTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWESDFIMPATE
GTQLVPCPAAVSTVAVPSAPLFSKKLSSSSSSMSMDTSASEPMPGEKRKLPESLTLEDAK
RIRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGN
SLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFR
MFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHTILYFLTYADEYAIGYFKKQG
FSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQI
RKVYPGLTCFKEGVRQIPIESIPGIRETGWKPLGKEKGKELKDPDQLYNTLKNLLAQIKT
HPSAWPFMEPVKKSEAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCRE
YNPPDSDYCKCANTLEKFFYFKLKEGGLIDK
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggctggcttctccccggaggagctgacagtgaggctggagggcaggagggtg
acggtgacagggaggcgtgagaagcagagtgctggagaggatggaggcagcttccaggag
tacctggagctgcgcagggaaatgctgctgcccgcagccctggacgtggaggctgtgact
tgctccctgtgctcagatggacagctccgcattgaggcaccacgcctggccctgcagccc
gcagaggggaaagccattcccatcagcatccaggcgggagagggagccacacaaggagac
actgccgccaaggaggagaaggagctgggaagggagcaccccgtggccaccctgagcgag
ccctgccggagctgcgggcacgccctggccgaccatgtgtcccacctggagaacgtctca
gaggaggagatcaaccggctgctgggcatggtggtggacgtggaaaacctcttcatgtcg
gtccacaaagaggaggacacggacaccaagcaagtgtacttctacctgttcaagctcctg
agaaagtgcatcctgcaaatgagccgtccggtggtggaagggtcccttgggagcccaccc
ttcgagaagcccaatattgagcagggagtcttgaacttcgtccagtacaaattcagtcat
ctgccgcccaaggagcgacagacaatgtatgaactctccaagatgtttctgctgtgcctc
aactactggaagctggagacgccctcccagttccggcagcgctctcaaaatgatgacgtt
gccacctacaaggtgaactacaccaggtggctgtgctactgccacgtgccccagagctgc
gacagcctgccccgctatgagaccactcacgtcttcggccgcagcctcctcaagtccatc
ttcaccgtcacccgccggcagctgctggagaaattccgcgtggagaaggacaagctggtg
cctgagaagcggacgcttatcctcacccacttccctaagttcctgtcaatgctggaggag
gagatctatggggagaactctcccatctgggagtctgacttcatcatgccagccacggag
ggcacccagctagtcccatgcccagcagctgttagtactgtggctgtgcccagtgcccca
ctgttcagcaagaagctcagcagcagcagctcctccatgagcatggacaccagtgcttcg
gagcccatgccaggtgagaaacggaaactgcctgagagcctgacgctggaagatgccaag
cgcatccgggtcatgggtgacatccccatggaactggtcaatgaagtgatgctgaccatc
acagaccctgctgccatgctggggccagagaccagcctgctgtcagcaaatgcggcgcgg
gacgagacagcgcggctggaggagcggcgtggcatcatcgagttccatgtcatcggcaac
tcactctcccagaaatccaacaagaagatccttatgtggctggtggggctgcagaatgtc
ttttcccaccagctgccccgcatgcctaaggagtatatcacacgcctcgtctttgacccc
aagcacaagacgctggctctgatcaaggatggccgagtgatcggggggatttgcttccgc
atgttccccacccagggcttcacggaaattgtcttctgtgctgtgacatccaacgagcaa
gtgaaggggtacgggacacacttgatgaatcacctgaaggagtatcacatcaagcacacc
atcctgtacttcctgacctatgccgacgagtatgccatcgggtacttcaagaagcagggc
ttctccaaggatatcaaggtgccaaagagtcgctacctgggctacatcaaggactatgag
ggggcaaccctgatggagtgtgagcttaacccccgcatcccttacactgagctttcccac
atcatcaagaagcagaaggagatcatcaagaagctgattgagaggaagcaggcacagatc
cgcaaggtgtacccaggcctgacctgctttaaggagggtgtgcggcagatccccattgaa
agcatccctggcatccgagaaacgggatggaagcccctggggaaggagaaagggaaagag
ctcaaagatccagaccagctctacaacaccctgaagaacctcctggcccaaatcaagacc
caccccagtgcttggcccttcatggagcctgtcaagaagtctgaggcacctgattactac
gaaatcatccgtttccctatcgatctgaagaccatgactgagcgcctgaagaaccgctac
tatgtgaccaagaagctcttcatcgcggacctgcagcgtatcatcaccaactgccgggag
tacaacccacctgacagtgactattgcaagtgcgccaataccctggagaagttcttctac
ttcaaactcaaggaggggggcctcatagacaagtag

DBGET integrated database retrieval system