KEGG   Alligator sinensis (Chinese alligator): 102370928Help
Entry
102370928         CDS       T02922                                 

Gene name
NEU2
Definition
sialidase 2 (cytosolic sialidase)
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102370928 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102370928 (NEU2)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102370928 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 380 aa AA seqDB search
MALLPLLHQETLFQKGPWSYRIPALLYVPQSSTILAFAEEREDVVDEHARLIAMYRGMYD
ATTHHVQWNKMETILSAQLEGHRSMNPCPVYDKVTGTLFLFFIAIPGKISEMHQIKTKTN
LVHLCHVTSTDSGCTWSSAKDLTNSVINTTHKEWATFAVGPGHGLQLSNESQNLVIPAYA
YRILDPGKTPSPHAFCFVSSDHGKTWTLGNFVEESAVECQVTEVHISGERVLYCNARSSR
GARVQAVSYNHGVDFESGQRIAKLVEPPHGCHGSVTAFPCPTDGKSGCQDSWVLYTHPTD
PTGRRDLGVYLNKCPLDPATWTEPSIICKGLCAYSDMQYLGQGPDGSPLFCCLFEFGTKL
QCEKIVFLMFTLKQVFPAQC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcttccccttttacatcaagagacattgttccaaaagggaccttggagctac
cgaattccagccctgctctatgtgccacaatcaagtaccatcctggcatttgcagaggag
agggaggatgtggtggatgaacatgccaggttgatagccatgtacagaggcatgtatgat
gcaactacccaccacgttcagtggaacaaaatggaaaccattctcagtgctcagctggag
gggcaccgatccatgaacccatgtccagtgtatgataaggttactgggacccttttcctg
ttctttatagccatcccaggaaagatctctgaaatgcaccagatcaaaacaaaaaccaac
ctggtacacttgtgccatgtcacgagcactgacagtggatgcacctggagctcagccaag
gatctcactaactctgtgattaacaccacacacaaggagtgggccacttttgcagtggga
cctggtcatggtctgcagttgtccaatgagtcgcaaaatctagtgattcctgcctatgcc
tatcgaatacttgaccctgggaaaacaccctccccccacgccttctgctttgtcagttct
gaccatggaaagacctggacgctggggaattttgtggaggagagtgcagtggagtgccag
gtcacagaagtgcacatcagtggagagagagtgctgtactgcaatgctagaagcagccga
ggtgccagagtccaggctgtgagctacaaccatggggtggattttgaaagtggtcagcgg
atagcaaagctggtggaacctccccatggctgtcacgggagtgttacagcctttccgtgt
cccactgatgggaagtcagggtgtcaagacagctgggtgctctatactcatccaacagac
cccactggacggagagacttaggagtgtatctcaacaagtgtcccttagatccagcaacc
tggacagaacccagcatcatctgtaagggtttatgtgcttactcagatatgcagtacctg
ggccagggtccagatggctcacccttgttctgctgcctctttgagtttggcaccaaattg
caatgtgagaagatagtcttcctcatgttcacgctgaaacaagtttttccggcacagtgc
tga

DBGET integrated database retrieval system