KEGG   Alligator sinensis (Chinese alligator): 102371017Help
Entry
102371017         CDS       T02922                                 

Definition
ribonuclease-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102371017
Messenger RNA biogenesis [BR:asn03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     102371017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 150 aa AA seqDB search
MYPRAPHAALLLFLLLTLVLSLVVEDHKESAYEKFQRQHVDEDSPSPYDDAYCTQRMQAK
NMTQRTCKIINTFIHAALPSIDDICTGAGNNTHDNYYYSYSDFNVTDCTFVSGSPPKECM
YSARFNTQKICIACTENLPVHYGPVSQCRP
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaagggctccccatgctgccctgctgctgttcctcttgctgaccctggtgttg
tccttggtggtggaggatcacaaggaatcagcctacgagaagttccagaggcagcatgta
gatgaggatagtccctctccatacgatgatgcctactgcactcagaggatgcaggccaag
aatatgacccagcgcacttgcaaaatcatcaacaccttcatccatgctgccttaccaagc
atagatgatatctgcacaggggctgggaacaacacacacgacaactattactatagctac
agtgactttaatgtcaccgactgcacttttgtaagtggctcccccccaaaagagtgtatg
tacagtgcaaggttcaatacccagaagatctgcattgcctgcactgaaaacctgcctgtg
cactatggcccagtgagccagtgcaggccatga

DBGET integrated database retrieval system