KEGG   Alligator sinensis (Chinese alligator): 102371017Help
Entry
102371017         CDS       T02922                                 

Definition
(RefSeq) ribonuclease-like
Organism
asn  Alligator sinensis (Chinese alligator)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 150 aa AA seqDB search
MYPRAPHAALLLFLLLTLVLSLVVEDHKESAYEKFQRQHVDEDSPSPYDDAYCTQRMQAK
NMTQRTCKIINTFIHAALPSIDDICTGAGNNTHDNYYYSYSDFNVTDCTFVSGSPPKECM
YSARFNTQKICIACTENLPVHYGPVSQCRP
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaagggctccccatgctgccctgctgctgttcctcttgctgaccctggtgttg
tccttggtggtggaggatcacaaggaatcagcctacgagaagttccagaggcagcatgta
gatgaggatagtccctctccatacgatgatgcctactgcactcagaggatgcaggccaag
aatatgacccagcgcacttgcaaaatcatcaacaccttcatccatgctgccttaccaagc
atagatgatatctgcacaggggctgggaacaacacacacgacaactattactatagctac
agtgactttaatgtcaccgactgcacttttgtaagtggctcccccccaaaagagtgtatg
tacagtgcaaggttcaatacccagaagatctgcattgcctgcactgaaaacctgcctgtg
cactatggcccagtgagccagtgcaggccatga

DBGET integrated database retrieval system