KEGG   Alligator sinensis (Chinese alligator): 102371384Help
Entry
102371384         CDS       T02922                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102371384 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102371384 (COMT)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102371384 (COMT)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102371384 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 262 aa AA seqDB search
MLESSPVLLFTVISLLLILLLLVLLIRNNGIAALIWNEIILEKITNFIMDQSKEQRILNF
VLQNAVRGDPQSVVDTIDKYCSQKEWAMNVGDEKGLILDKILEEAKPSTSLELGTYCGYS
AVRMARLLKPSARLLTIEFNAEFAAIAKQIIEFAGVQEKVPLIXGPSEEIIPQLKKKHEV
DTLDFVFLDHWKERYTPDTILLQECGLLRKGTVILADNIVCPGAPEFINYIRNNSHFECT
NYPSHLEYMKVKDAMEKAVFLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagctctcccgtccttttgttcactgtcatcagcctgcttctcattttgctg
ctccttgtactgctcattagaaacaacggcatcgcagcccttatctggaatgaaatcatc
ctggagaaaataaccaatttcatcatggatcagagcaaagaacagaggattttaaacttt
gtgctgcagaacgctgtcagaggggacccccagagcgtggtggacaccatcgataagtac
tgctcccagaaagagtgggccatgaatgtgggggatgaaaaaggtttgattctagataag
atactggaggaggccaagccctcaacctcattggagctgggaacatactgtggttattca
gctgtgaggatggctcggctgttgaagcccagcgcccgcctgcttaccattgagttcaac
gctgagtttgctgccattgccaagcagataattgagtttgctggagtacaagagaaggta
cctctgatttaaggcccttcagaggaaattatcccacagctgaagaaaaagcatgaagtg
gatacactggattttgtctttctcgaccattggaaagaaagatacacaccagatactatc
ctgttgcaagaatgtggcttgctgaggaagggcacggttatcctggctgacaatatagtc
tgtcctggggctcctgagttcattaactacatccgcaataacagtcatttcgagtgtacc
aactacccgtctcacctggagtacatgaaggtcaaagatgccatggagaaggccgtgttt
ctgggataa

DBGET integrated database retrieval system