KEGG   Alligator sinensis (Chinese alligator): 102371384Help
Entry
102371384         CDS       T02922                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:asn00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:asn00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 262 aa AA seqDB search
MLESSPVLLFTVISLLLILLLLVLLIRNNGIAALIWNEIILEKITNFIMDQSKEQRILNF
VLQNAVRGDPQSVVDTIDKYCSQKEWAMNVGDEKGLILDKILEEAKPSTSLELGTYCGYS
AVRMARLLKPSARLLTIEFNAEFAAIAKQIIEFAGVQEKVPLIXGPSEEIIPQLKKKHEV
DTLDFVFLDHWKERYTPDTILLQECGLLRKGTVILADNIVCPGAPEFINYIRNNSHFECT
NYPSHLEYMKVKDAMEKAVFLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagctctcccgtccttttgttcactgtcatcagcctgcttctcattttgctg
ctccttgtactgctcattagaaacaacggcatcgcagcccttatctggaatgaaatcatc
ctggagaaaataaccaatttcatcatggatcagagcaaagaacagaggattttaaacttt
gtgctgcagaacgctgtcagaggggacccccagagcgtggtggacaccatcgataagtac
tgctcccagaaagagtgggccatgaatgtgggggatgaaaaaggtttgattctagataag
atactggaggaggccaagccctcaacctcattggagctgggaacatactgtggttattca
gctgtgaggatggctcggctgttgaagcccagcgcccgcctgcttaccattgagttcaac
gctgagtttgctgccattgccaagcagataattgagtttgctggagtacaagagaaggta
cctctgatttaaggcccttcagaggaaattatcccacagctgaagaaaaagcatgaagtg
gatacactggattttgtctttctcgaccattggaaagaaagatacacaccagatactatc
ctgttgcaagaatgtggcttgctgaggaagggcacggttatcctggctgacaatatagtc
tgtcctggggctcctgagttcattaactacatccgcaataacagtcatttcgagtgtacc
aactacccgtctcacctggagtacatgaaggtcaaagatgccatggagaaggccgtgttt
ctgggataa

DBGET integrated database retrieval system