KEGG   Alligator sinensis (Chinese alligator): 102371807Help
Entry
102371807         CDS       T02922                                 

Gene name
TGM4
Definition
transglutaminase 4
Orthology
K05621  
transglutaminase 4 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 705 aa AA seqDB search
MEEKRKHITENKELSILESQENQLQTLGVDLLKWQNARLHHTDAYDNKSLIVRRGQEFQL
KLMFDRELKDNDKVGLQFSFGDKPMKSSGTLVAMTLRSQQDSQCWSAKIANTNGKECLVT
VASPADAAIGKYLLCVKTGADVYKPGNTVYLLFNPWCKADAVFMPSDAERLEYVLNDTGY
LYVGSSEKIFEKPWNFGQFEEDVLDSCMYLLDKSGLKQNFRKDPVTVSRTMSALVNSNDD
AGVLFGNWSGNYGSGTSPLAWTGSATILQKYYKTKKPICFGQCWVFSGVLTTVMRCLGIP
ARSVSNFASAHDTQENLKVDIFLNECGEKVDKLTTDSVWNFHVWNDVWMKRSDLPEGFDG
WQAIDATPQEISQGIFQCGPSPLKAIRSGEVYLPYDSKFIFAEVNADKVYWLVKNVAGKD
KYIKLREETKAIGKNISTKAIGKNMREDITAQYKFLEGSSEERKTMEKACSFLRCSDMVD
ARLSSSPLTAGIQLKTDGEKSLWPGNPIDLKIIVNSTSAESWTASLTASCQLQSYTGKVE
ANLGFIKQTVQTEGKPAIEIPLNVAADTYIKTLASVEDELLIKVNIIAEVQETGEKVSDE
LTLAFQYPSIKVEMPETAKINEAFTCAFVFKNTLAIPLEKCKLYVEGLGFFKMEIFDEGD
IRPGGIFKSKIICHPKKAGEKKIIAQLNSLQVKGISVEKIIIITE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaaaggaagcacatcacagaaaacaaggaactgagtattttggaaagccag
gagaaccaactccagacccttggagttgatttactcaaatggcaaaatgcccgtcttcac
cacactgatgcatacgacaataaaagtctgattgtaagacgtggacaggagtttcagctg
aaactgatgtttgacagagagctgaaagacaatgacaaagtggggctgcagttcagtttt
ggtgataaaccaatgaaatccagtggaaccctggtggcaatgaccttgaggtctcaacaa
gactctcagtgctggtctgccaagattgctaacaccaatggaaaggagtgcctggttact
gtggccagtccagcagatgcagctattggaaaataccttttgtgtgtgaaaactggagct
gatgtttataaacctggaaacactgtctacttgttgttcaacccttggtgtaaagctgat
gccgttttcatgcctagcgatgctgaaaggctggagtatgttctcaatgacacaggctac
ctctatgttggatcatcagaaaaaatatttgagaaaccctggaactttgggcagttcgag
gaagatgtcttggactcctgtatgtatctcctagacaaaagtggactcaagcaaaacttc
agaaaggatcccgtgactgtgtccaggaccatgtctgctttggttaattccaatgatgat
gcaggagtcctgtttggaaactggtcaggaaattatggtagtgggacctctccattggcc
tggacaggaagtgccacaattttacagaaatattacaaaactaaaaagcccatctgtttt
ggccagtgttgggtcttctctggagttctgactacagtcatgcgctgcctgggaatccct
gccagaagtgtgagtaactttgcttcagctcacgatactcaggaaaatctgaaagttgac
atcttcctgaatgaatgtggagaaaaagtggacaagctgaccacagactctgtctggaat
ttccacgtgtggaatgatgtgtggatgaaaaggtcagacctgccggagggctttgatggc
tggcaggcaatcgatgccactccacaagagataagtcaaggtattttccagtgtggccct
tctccactgaaagctatcagaagcggagaagtctatttgccctatgactccaagtttata
tttgctgaagtgaatgctgataaggtttactggcttgtgaagaatgtagccggcaaagac
aaatacatcaagctccgcgaggagaccaaagccattgggaagaacatcagcaccaaagcc
attggaaaaaacatgcgggaagacatcacagctcaatacaagttcttggaagggtcatca
gaggaaaggaaaaccatggaaaaagcttgctcctttctcagatgttcagatatggtagat
gctaggctctcctcttctccactcacagctgggatccagctgaagacagatggtgaaaaa
tctttgtggccgggcaaccccattgatttgaaaatcattgtaaacagcacttcagctgaa
tcatggacagccagtctcactgcctcttgccagctgcagtcctatactgggaaagtagag
gccaatcttggatttatcaagcagactgtccagactgaaggcaaacctgcgattgagatc
cctctgaatgtggcagctgatacttacataaagacactggcatctgtggaggatgaactt
ctcatcaaagttaatattattgctgaggttcaggaaacgggtgaaaaggtttctgatgag
ctaacgcttgcattccaatacccctctataaaggtggagatgccagaaacagcaaagatc
aatgaagctttcacctgcgcctttgtcttcaagaatacactggcaattcctttggaaaag
tgtaaattgtatgtagaaggactgggatttttcaaaatggaaatatttgatgaaggagac
ataagacctggcgggatctttaaatctaagattatctgtcatcctaagaaagctggagag
aaaaaaataatagcccagctaaactctctgcaggtcaaaggaatatctgtggaaaagatc
atcatcatcactgagtag

DBGET integrated database retrieval system