KEGG   Alligator sinensis (Chinese alligator): 102371912Help
Entry
102371912         CDS       T02922                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:asn00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102371912 (EP300)
   04330 Notch signaling pathway
    102371912 (EP300)
   04350 TGF-beta signaling pathway
    102371912 (EP300)
   04630 Jak-STAT signaling pathway
    102371912 (EP300)
   04068 FoxO signaling pathway
    102371912 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102371912 (EP300)
  Cell communication
   04520 Adherens junction
    102371912 (EP300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102371912 (EP300)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102371912 (EP300)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102371912 (EP300)
Transcription factors [BR:asn03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102371912 (EP300)
Mitochondrial biogenesis [BR:asn03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102371912 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2449 aa AA seqDB search
MAENVVEPGPSSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGMAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMASQTQQNSPGMGILNS
MVKSPMAQAGLTSPNMAMGTSGPNQGPMMPTVNSPVNQPGIGMNTGMNAGMNPGMLAAGN
GQGMMQGQVINGSIGAGRGRPNMPYPNPGMGNAGNLLAETLQQGSPQMGGQTGLRGPQPG
AMNKMGMMSNPSPYGSPYSQNTGQQIGASGLGPQMQNKAGLPNSLPQFTMDKKPPVPGAX
MPNMGQQQAPQVQPAGMVPAAPQAMGSGAPTADPEKRKLIQQQLVLLLHAHKCQRREQAN
GEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK
NAGDKRNQQSLLGGATVGLANTGTVGVGQQTTSSINTTSQIDPSSIERAYAALGLTYQGN
QMQTQSQAQVKNQQQGQSPQGLRPMNPMSANPMGVNGGVGVQTPNLLPDSMLHSTMNSQN
PIMSESASVASLGAMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALK
DRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQSMIPNA
PGMPQAPMNQGPNMGQPQPGMSANGPLPDPTMIRASVPNPMMNRMQTQPGMNQFSQMNMP
LSTMGPRQTPPLQHPGQLSQAGAMNQQMGFPSRMQQPGVGQPSSQSQFLQQTQFPASSPG
MNATSMPMTQPGNQPPVSQAQMTSSSCPVNSPAMAPGSQGSHIHCPPLPQPPLHRNSPSP
VPSRTPTPHHTPPGLGSQPQQQQQAAAAAAATTAPTPTPQAMPPGPPSQTMHPPQRQTPT
PPQVQLPPQVQPPVPVTPSAEQQQPLSQQSTTASVPTPTAPLQPTHPTTPLSQPAVSVDG
QVSNPPSTSSTEVNSQQNAPEQQQPPLQEVKMEIKMDEEEPEQTDLQGEEKPEIKVEPVV
EECKPDPMEQEEKKAEVKSEMKDEEERPSTPATQSSPAAGQSKRKIFKPEELRQALMPTL
EALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIW
LMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQL
CTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPE
LFVECIECGRKMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFL
ENRVNDFLRRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFA
FEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYL
EYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHD
YKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSK
GDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIA
GPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQS
QDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTA
TTQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPIC
KQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVG
QQQGLPSPTPATPTTPTGQQPPTPQTPQPQPPPQPATQPQPAPPNNMPPYTIPRNQPPGA
VSQGKAGGQGTPPTPPQTAQPPVQGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHP
MPQMNPMPPMGMNPPQMTRGPGGHIDQAMGPAGIQQQPPWAQGGLPQPQQLQPGMQRPSM
MSVAQPGQPMNMAPQPGMGQVPGTAQPKQGSLPQAALQNLLRTLRSPSSPMQQQQVLNIL
HSNPQLLAAFIKQRAAKYAGSQNPQGMPGQPGMPPGQPGLQPQQAMQGQQAGVHPNPTMQ
NMNPMQAGVQRPTMPQQPQQQQPQQAMGGMNPQTQPMNMNHSGMNPQFRDLLMRRQMIEQ
QRHQQQQGAGPGLGPGMANHNQFQQPQGVGYPQQQQQQQRMQHHMQQMQQGNMGQMSQLP
QAMSAETGASLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPSQAQSPHLQGQQIPSSLTN
QVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQGNPMDQGHFA
SPDQSAMLSQLASNPGMAGLHGTSATELGLSSDNSDLNSNLSQSTLDIH
NT seq 7350 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgtcttcagccaagcggcctaaactctcctca
ccggcgctctccgtgtccgccagcgacggcacagattttggatctctctttgatctggaa
catgacttacctgatgaacttatcaactccacagaattgggacttactaatggtggtgac
attaatcagctgcagactagccttggtatggcacaagatgctgcttctaaacacaagcag
ctatctgaactcttacgggctggtagctccccaaacctcaacatgggtgtgggtggacct
ggccagggcatggccagtcaaacccaacagaatagccctggaatgggaatcttaaacagt
atggttaaaagccctatggcacaggcaggactgacttctcccaatatggcaatgggcaca
agtgggccaaaccagggtccaatgatgccaacagtaaatagtccagttaatcagcctggc
ataggaatgaatacagggatgaatgctggtatgaatcctgggatgctggcagcaggcaat
ggacaaggaatgatgcaagggcaagtaataaacggttcaattggagcaggaagaggacgt
ccaaacatgccgtatccaaacccaggaatgggtaatgctggcaacttgttggctgagacc
ctgcagcaaggctctccgcagatgggaggacagacaggactgagaggaccacaacctgga
gcaatgaacaagatgggaatgatgagtaatcccagtccttatggctcaccatacagccaa
aacactgggcagcagattggagccagtggacttggtccccagatgcagaataaagctggt
ctaccaaacagtttaccccagtttacaatggacaagaagccaccagtccctggtgcatga
atgccgaacatgggccagcagcaagcgccgcaggtccaaccagctgggatggtgccagct
gctccccaagctatggggtcaggggcccctacagcagacccagagaaacgtaagctcatt
caacagcagctcgttctcctcttacacgcccacaagtgtcagcggcgagaacaagccaat
ggtgaggtgcgacagtgcaacctccctcattgccgtaccatgaagaatgtcctcaaccac
atgacacactgccaggctggcaaatcttgccaagtggcacactgcgcatcttcacgacaa
atcatctcgcactggaagaattgtacaagacatgactgtcctgtatgtttgcctcttaaa
aatgctggggacaaaagaaatcaacaatcgttattaggcggagctacagttggacttgca
aacactggcactgtaggggtggggcagcagactacgtccagtataaacactaccagtcaa
attgaccctagctctattgagagagcctatgcagcccttggactgacctatcaaggaaac
cagatgcagacacaatcccaggctcaagtgaagaatcaacagcaagggcagtcaccccag
gggttgcgccccatgaatcccatgagtgcaaatcccatgggagtgaatggaggtgtgggg
gttcaaacccctaatctactacctgactcaatgttgcattcaaccatgaattcccaaaat
cccataatgagcgagagcgccagtgttgccagtttgggggctatgccaacagcagcacaa
ccatccaacactggaattcgaaaacagtggcatgaagatataactcaggaccttcgaaat
catcttgttcataaactagttcaagccatatttcctactcctgaccctgcagcattaaaa
gacaggcgcatggagaacctggtagcatatgctcgaaaagtggaaggagatatgtatgaa
tcggcaaatagcagggcagagtactatcacttgctagctgagaagatatataaaatccag
aaggaattagaggaaaagcggaggaccagactgcagaagcaaagcatgataccaaatgca
ccaggcatgcctcaagctcccatgaatcaagggcctaatatggggcagccacagccaggg
atgtctgcaaatggtcctcttcctgacccaaccatgattcgagccagtgtgccaaacccg
atgatgaatcgcatgcagacgcagccaggtatgaatcagtttagccagatgaacatgccg
ctgtcaacaatgggaccccggcaaacccctcctcttcagcaccctggacagctaagccag
gctggggccatgaaccagcagatgggctttccttcacgtatgcagcagccaggggttggc
cagccttccagtcagagtcagtttctgcaacagacccagttccctgcctcctccccagga
atgaatgctacaagcatgcctatgacccagcctggcaatcagcctccagtatctcaagca
caaatgaccagctcttcctgtcctgtgaactctcctgcaatggctcctggttctcagggg
agccatattcattgcccaccgcttccacagcctcctttgcaccgaaactctccctctcca
gtacctagtcgaaccccaacacctcatcacacacccccaggcctgggatcccagccacag
caacagcagcaagcagcagcagctgcagcagccaccactgcccccacccctacccctcag
gcaatgccacctggacctccatcacaaactatgcaccctcctcagaggcagactccaact
cctccacaggtacagctgcctccgcaagtgcagcctccagttccagtcaccccttcagca
gagcagcagcaacctctgtcacagcagagcacaactgcatctgtgccgaccccaacagca
ccgctgcagcccacacaccccacgacacctctttcacagccggctgtgagcgttgatggg
caggtatctaacccaccatccaccagcagcacggaggtgaattctcaacagaatgctcct
gagcagcagcaaccacccttgcaggaagtgaaaatggaaattaaaatggatgaagaggag
ccagaacaaacagaccttcagggggaggagaaacctgagattaaagttgaacctgtggtg
gaggaatgtaaaccggacccaatggaacaggaggaaaagaaagcagaagtgaagtctgag
atgaaagatgaggaagaaagacccagtactccagctactcagtcttctccagcagctggg
caatctaagaggaaaattttcaaaccagaagaattgcggcaggcgcttatgccaacactg
gaggcactttacaggcaggatcctgagtcccttcctttccgacaacctgtggatcctcaa
ctactaggaattcctgattactttgatatagtgaagaaccccatggatctctctaccatc
aagagaaaactagacacagggcagtaccaggagccttggcagtatgtggatgacatctgg
ctcatgttcaacaatgcctggctctataaccgcaagacatcccgagtgtataagtactgc
tccaaactggcagaggtgtttgaacaagaaattgacccagttatgcaaagccttggttat
tgctgtgggagaaagttggaattctcaccacagactttatgttgctatggcaaacagcta
tgcacaatccctcgagatgccacttattacagttatcagaacaggtatcatttctgtgag
aagtgcttcaacgaaatccaaggggagagcgtttctctgggggatgacccatcacaacct
caaactacaataaacaaagagcaattttctaagaggaaaaatgatacactggaccctgaa
ctgtttgttgaatgtatagagtgtgggagaaaaatgcaccagatctgtgtccttcataat
gagataatctggccttctggttttgtctgtgatggctgcctaaagaaaacaggtcgaacc
aggaaagagaacaaattttctgctaaaaggttacctgctacaagacttggtaccttcttg
gaaaacagagtcaatgacttcctgagaagacagaatcaccctgaggcaggagaggtcaca
gttagggtggttcatgcctctgacaaaactgtagaagtaaaaccaggaatgaaagcaagg
tttgtagacagcggagagatggcagagtccttcccctatcgaacaaaagctctctttgcc
tttgaagaaattgatggtgtagacttgtgcttcttcggcatgcatgtacaggagtatggc
tcagattgccctccgcccaatcagaggcgagtgtatatatcttacctcgatagtgttcat
ttcttccgccctaaatgcttgaggactgcagtctatcatgaaatactaattggataccta
gaatacgtcaaaaaattaggatatactactggtcatatctgggcctgcccaccgagcgaa
ggagatgactacatcttccattgccatccacccgatcagaagatacctaagcccaagcga
ctgcaagagtggtacaaaaaaatgctggacaaatcagtgtctgagcgtattgtccatgat
tacaaggatatcttcaagcaagcaacagaagatcgtctaacaagtgcaaaagagctgcct
tactttgaaggggacttctggcccaatgtgctagaggagagtattaaggaactagaacaa
gaggaggaagagcgaaagagagaagagaacactagtaatgagagcacagatgtgagcaag
ggagacagcaaaaatgccaaaaagaagaacaataagaagacaagtaaaaataagagcagc
ttgagtcggggcaataagaaaaagcctggcatgcccaatgtctccaatgatctttcacag
aagctgtatgccactatggagaagcacaaggaggtcttcttcgtgatccgtctcattgct
ggccctgcagccaattccctgcctcctattgttgagcctgatccactcattccatgcgac
ttaatggatggacgtgatgccttcctcacccttgctagagacaaacacctggagttctct
tcactccgaagggctcagtggtcaaccatgtgtatgttggtggagctgcatacccagagt
caggatcgttttgtttatacctgcaatgagtgcaagcatcatgtggagaccagatggcac
tgcactgtctgtgaggattatgacctgtgcatcacctgctataacactaaaaaccatgac
cacaagatggagaaattgggcctgggcctagatgatgagagtaacaaccagcagactgca
accacacagagccccggtgactcccgccgcctgagcatccagcgctgtattcagtccctg
gtccatgcctgtcagtgtcgtaatgccaactgctcactgccgtcctgtcagaaaatgaaa
cgggttgtccagcacaccaaaggctgcaagcgcaaaaccaatggagggtgtcctatttgc
aaacagctcatcgctctttgctgctaccatgcaaagcactgccaggagaacaagtgtccc
gtgcccttctgcctcaacattaaacacaagctccgtcaacagcagcttcagcaccgcctg
cagcaggcccagatgctccgaaggaggatggcaagcatgcagaggactggcgtggtaggt
cagcagcaaggattgccctcaccgacaccagccacgccaacaactccaacaggccagcag
cccccaacacctcagaccccacagcctcagccaccaccccagcctgccacgcagccccag
cctgcacctcccaataacatgccaccctacactataccaagaaatcagcctcctggtgcg
gtgtcccagggcaaagcaggtggccagggaactcctccaactccacctcagactgctcag
ccaccagttcaaggtcctcctccagctgcagtggaaatggccatgcaaatccagcgggca
gcagaaactcagcgtcagatggcacatgttcagattttccaaaggccaattcagcaccca
atgccgcagatgaatccaatgccacccatggggatgaaccctccccagatgaccagaggt
cctggtggtcacatagatcaagccatgggaccagcaggcatccagcagcagccaccatgg
gcccagggagggttgccccaacctcagcagctgcagccaggaatgcagaggccatccatg
atgtcagtagcccagccagggcagcctatgaacatggcacctcagcctgggatgggccag
gtacctggtacagctcagccaaaacaaggatctctgccccaggcagcattacaaaactta
cttcggactctcaggtctcccagctcccccatgcagcagcagcaggtgcttaacatcctt
cactccaatcctcagctactggctgcattcatcaaacagagggcagctaagtatgctgga
tctcagaacccgcaaggtatgccagggcagcctggaatgccacccggacagcctgggctt
cagccacagcaggccatgcaagggcagcaagcaggggtgcacccaaacccaaccatgcag
aacatgaaccccatgcaagcaggcgtccagaggcccaccatgccgcagcaaccacagcaa
cagcagcctcaacaagccatgggtgggatgaaccctcagacgcagccgatgaacatgaac
cattcggggatgaacccacaattccgggatcttttaatgagacggcagatgatcgaacag
cagcgccaccagcagcagcaaggtgcaggaccagggttgggtcctggaatggccaaccat
aatcagtttcagcagccccagggggttgggtacccccagcagcagcagcagcagcaacgg
atgcagcatcacatgcagcagatgcagcaaggaaatatgggacaaatgagccagcttcca
caggcaatgagtgcagagacaggagccagtttgcagcaggctttccagcagaggctactt
cagcagcagatggggtctccagctcagcccaaccccatgagcccccaacagcacatgctt
cccagtcaggcccagtccccacacttacagggccagcagatcccttcatcactcaccaat
caagtgcgttctccgcagcctgtaccttcaccacgaccccagtcccagcctccccattcc
agcccttcccctcggatgcaacctcagccttctccacaccacgtctccccgcagaccagc
tccccacatccaggactggtagctgcccagggtaaccccatggatcaagggcactttgcc
agcccggaccagagtgcaatgctttctcagctcgctagtaatccaggcatggcaggcctc
catggtacaagcgccacggaactggggctcagctccgataactcagacttgaattcaaac
ctttcacagagtacactagacatacactag

DBGET integrated database retrieval system