KEGG   Alligator sinensis (Chinese alligator): 102372191Help
Entry
102372191         CDS       T02922                                 

Definition
protein-glutamine gamma-glutamyltransferase 5-like
Orthology
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 765 aa AA seqDB search
MHREHKGPRDKKGAVSCRQHMGSTEKRPRVRRVGLKRPRFPLALGLQVGFTDFQCYRNNL
QHQTAEMSTKHLVVRQGQPFTITLHFHGRGYQPGVDTILLIVETGPNAEKSSGTRAVFPV
ARSGPTSSWRAVCARTSPSCVEITLSAPANAVIGRYLLKARVDSGTGQATSYQLGEFTLL
FNAWSPADDVYLASETARQEYVVNDYGFIYQGNKNWIHPCPWNYSQVEEGVVDICLRLLD
RSLNFQHDPVEDCSLRNSPVYVSRVVSAMINSNDDSGVLLGNWSEDYSGGICPSEWTGSV
AILRQWDATGAQPVKYGQCWVFAAVMCTVMRCLGVPTRVVTNTESGHEKDGNLVIDEYYN
TMGHILATESKDSIWKFHVWNECWMARRDLSPGYAGWQVLDATPQETSNGLYCCGPASVK
AIKEGELHLSYDTPFVFSMVNVYRVVWLIYGARKEKLLCDSRCVGNHISTKSIGRDERKD
ITDSYKYREGSQEERQVFAKALARAQHRKAQGPSTAEPQASRFLPGLRASLDVSSPAECR
GQEAPSKVHTCLRLKLAKSPEVGQDLGLVLLAENLAFEHKDLKLSISTGSVLHDGAPLPP
FWQNTLYIPFRPKEEKVIPWTISYAQYGRHLSQDRLVRVSVVGEENSTWEKLLVERIITL
AYHAILINVLSPIAANRPFALEVEITNPLHEPARDCVLTMEGSGLLKEQFRLDMGVLRAQ
ERSNITFQIIPFKTGQRQLQVNFKSNKVKDIKGHTTLIVAPNIRF
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgagaacacaaggggcctcgagacaagaagggagctgtcagctgtcgccagcac
atgggcagcacagagaaaaggcccagagtcaggagagtgggactgaagagaccccgcttt
cccctggccctaggactgcaggttgggttcactgacttccagtgctatagaaacaacctg
caacaccaaacagcagagatgagcaccaagcacctggtggtgcggcaggggcagcctttc
accatcaccttgcacttccacggccggggctaccagcccggggtagacaccatcctgctt
atcgtagagacagggccaaatgccgagaaatcatcgggaacgcgagctgtattccctgtg
gctagatctggccccacaagcagctggagggcagtctgcgcgcgcaccagccccagctgc
gtggaaatcacactgtctgctccagccaacgcagtcatcggccgctacctgctgaaggct
cgtgttgactctggcacgggccaggccacctcctaccagctcggggaattcaccctgctc
ttcaacgcatggagcccagctgacgatgtgtatctggcaagcgagacagcaaggcaggag
tatgtagtgaatgactatggcttcatataccagggaaacaagaactggatccatccatgt
ccctggaactattcgcaggtcgaggagggcgttgtggacatctgcctgaggctgctggac
aggagcttaaacttccagcacgaccctgtcgaggactgttccttacgcaacagccccgtc
tacgtcagccgggtggtgagcgcgatgatcaacagcaatgatgacagcggggtcctgctt
gggaactggagcgaagactactctggcggcatctgcccatccgagtggaccggcagtgtg
gccatcctgcggcagtgggacgccacaggagcccagccggtgaaatacgggcagtgctgg
gtcttcgcagcggtgatgtgcacagtgatgagatgtctgggggtcccgacacgtgttgta
accaacactgagtcaggccatgagaaagatggaaacctggtcatcgatgagtactacaat
accatgggccacatccttgccacggagagcaaggacagcatctggaagttccacgtctgg
aatgagtgctggatggcacggagggacctgtccccaggctacgccgggtggcaggtgctg
gatgcaacacctcaggaaaccagcaatgggctctactgttgtggtcctgcctcagtcaaa
gccatcaaagaaggagaattgcacctttcctatgacactccctttgtgttctcaatggtg
aatgtgtaccgcgttgtctggctgatctatggtgcaaggaaagagaaacttctctgcgat
tctcgctgtgttgggaaccacatcagcaccaagagcattgggagagatgagcgcaaggac
atcactgacagctacaagtacagggaaggctcccaggaggaaaggcaggtgtttgcaaag
gctcttgctagggctcagcacagaaaggcacaagggcccagcacagcagagccccaggct
agcaggtttctgccaggactgagggcctccctggacgtatccagcccagctgagtgccgt
ggccaggaggctccgagcaaggtgcacacctgcctgaggttgaaactggccaagtcccct
gaggttggccaggacctcggcctggtcctgctggctgagaatttggcttttgagcacaag
gacttgaagctgagcatcagcaccgggtctgtgctgcatgacggcgctcccctgcctccg
ttctggcagaacaccctgtacatccctttccgtcccaaagaagagaaggtcatcccatgg
acaatctcctacgcccagtatgggagacacctgtcccaagacaggctggtgcgagtgagc
gttgttggggaggagaactccacctgggaaaagctgctggtggaaaggatcatcaccctg
gcttaccacgctatcctcatcaatgtcttgtcacccatagcggcgaaccgcccgtttgcc
cttgaggtcgagatcaccaaccctctgcacgagccagccagggactgtgtcctgaccatg
gagggcagcggcctgctcaaggagcagttcagacttgacatgggagtcctcagagcccag
gaaaggtccaacatcactttccaaatcatccccttcaagacgggccaaaggcagctgcaa
gtcaacttcaagagcaacaaggtcaaggacatcaaaggtcacacaactctcatagtagct
ccaaatataagattttaa

DBGET integrated database retrieval system