KEGG   Alligator sinensis (Chinese alligator): 102372602Help
Entry
102372602         CDS       T02922                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:asn00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:asn00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:asn00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:asn00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:asn00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MASMLLSRQLTCSLQQNSRLLVFGHRSISQAAAKIDLDFDYDGPLMKTEVPGPRSRELMK
ELNGIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYCQISSIPIGYSHPSLIKLLQQPQ
NLSTFINRPALGILPPENFTEKLKESLLSVAPKGLQQVFTMACGSCSNENAFKVTFMWYR
NKERGRNSVTKEELETCMINQAPGCPDYSILSFMGGFHGRTMGCLAATHSKAIHKLDIPS
LDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKVVAGIIIEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGCGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPAKNLMLAEVINVIKREDLLNNATHAGKALLTGLL
DLQARYPHLISRVRGRGTFCSFDAPNDATRDKFITIARNKGVVLGGSGDRSIRFRPTLIF
KDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatgttgctcagtagacagctgacttgttctctgcaacaaaactccaggctg
cttgtatttggacacaggtctatcagtcaggctgcagctaaaattgatttggattttgat
tatgatggacctttaatgaagacagaggttcctgggcctagatccagagaattaatgaaa
gagctaaatggaattcagaatgcagaagctgtgcactttttttgcaattacgaggagagc
cgaggaaactaccttgtagatgtagatgggaaccgcatgctggacctctactgtcagatt
tcatccatcccaataggttacagccatccatctctaataaagcttctacagcagccacag
aatttgagtacttttattaacagacctgctctagggattttacctccagagaacttcact
gaaaaactaaaggaatctttgctttcggttgctcctaagggcttgcagcaggttttcacc
atggcctgtggctcttgctctaatgaaaatgcctttaaagtaacattcatgtggtacagg
aacaaggagcggggtcgtaatagcgtcacaaaggaagaactggaaacttgcatgattaac
caggctccgggttgcccagactacagtattttgtcctttatgggtggatttcatggaaga
actatgggttgcttagctgcaactcactctaaagcaattcacaaattagatatcccatca
ctggactggcctattgctccatttccaagactaaaatatcctctggaagagtttgtgaaa
gagaatcaacaggaagaagcccgctgtttagaagaggtggaagatctgattgtgaagtac
aggaaaaagaagaaggttgttgctggaataattattgaaccaattcagtcagagggagga
gacaatcatgcttcagatgacttcttcaggaagctaagggacattgctagaaagcatggc
tgtgcatttctggtggacgaggtgcagacaggatgtggttgcactgggaagttttgggcc
catgaacactggggcttggatgacccagctgatgtggtaacatttagtaagaagatgatg
actggagggttttttcacaaggaggagttcagacccaatgctccataccggatttttaac
acttggcttggagatcctgccaaaaatctcatgcttgctgaagtcattaatgtaattaaa
agagaggaccttctaaacaatgcaacccatgcagggaaagcactgctgactgggctgttg
gacttgcaggctcgttatccccatctaatcagcagagtgagaggacgagggacattctgt
tcatttgatgctccaaatgatgcaactagggacaagtttattaccattgccagaaacaaa
ggtgtcgtgctgggaggcagtggtgatagatcgattcgttttcgtccgaccctaattttc
aaggatcaccatgcacatctctttctgaacatcttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system