KEGG   Alligator sinensis (Chinese alligator): 102372928Help
Entry
102372928         CDS       T02922                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1 (muscle)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102372928 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102372928 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102372928 (GYS1)
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102372928 (GYS1)
Glycosyltransferases [BR:asn01003]
 Polysaccharide
  Storage polysaccharide
   102372928 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 721 aa AA seqDB search
MPLARSLSVTSLTGLEDWEDEVDLENVVLFEVAWEVANKVGGIYTVIQTKAKITSDEWGE
NYFLIGPYLEQNVRTQVELLDPPNPAMRRTIESMNSKGCKVYFGRWLIEGGPYVVLLDIT
ATAWSLDRWKTELWDSCTIGVPWYDREANDAVLFGFLTAWFLGEFTAQCEEKPFIIGHFH
EWLSGVGLFLCRIRKLPVATIFTTHATLLGRYLCAGSVDFYNNLQTFNVDKEAGDRQIYH
RYCMERAAIHCTHVFTTVSQITAVEAEHLLKRKPDLVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADIFLEALARLNYLLRVNGSES
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANAVKEKFGKKLYESLLVGNLPDMNKML
DKEDFTMMKRAIFATQRHSFPPICTHNMLDDSTDPILNTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCTQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRVSLTDASLSLSLPFPXAQGFRYPRPASVPPSPSISRHSSPHHSETEEDDERYDEDEE
AEKDRQNIKPPATMGPVPDWRKQPKKLSSEASTSSNASTPTLPSSPSDLSSPGSSIIEER
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcccttggctcgcagcctctccgtcacctccctgactgggctggaggactgggaggat
gaggttgacttggagaacgtggtcctcttcgaagtggcctgggaggtggccaacaaagtg
ggtggcatctacacggtgatccagacgaaggccaagatcacgtcagatgagtggggcgag
aactacttcctcatcgggccctacttggagcagaacgtccgcacccaggtggagctcctt
gacccgcccaacccagccatgcggcgcaccatcgaatccatgaactccaagggctgcaag
gtgtacttcgggcgctggctcattgaggggggcccctacgtggtgcttctggacatcaca
gctacggcctggagcctggaccgctggaagacagagctatgggacagctgcaccatcggg
gtgccctggtacgaccgtgaggccaacgacgctgtcctcttcggcttcctcaccgcctgg
ttcctgggggagttcacagctcagtgtgaggagaagccatttatcatcgggcacttccac
gagtggctgtccggagtcgggctcttcctgtgccgcatccgcaagctgcctgtggccacc
atcttcaccacccacgccacactgctgggccgctacctctgtgctggcagtgtggacttt
tacaacaacctgcagacttttaacgtggacaaagaggctggtgaccggcagatttaccac
cgctattgtatggagcgtgctgccatccactgtacccatgtcttcaccaccgtgtcccag
atcacagctgtggaagctgagcacctgctcaagaggaaaccagacctggtgacccccaat
ggcttaaacgtgaagaaattctcagccatgcacgagttccagaacttgcacgcccagagc
aaagcccgcatccaggagtttgtccgggggcatttctatggacacttggacttcaacctt
gataaaaccctcttcttcttcattgctgggcgctatgagttctccaacaagggggctgac
atcttcctggaggctttggcccgcctcaactacctgctgcgggtgaatggcagcgagagc
acagtggtggccttctttatcatgccagcgcggaccaacaatttcaatgtggagaccctc
aaggggcaggctgtgcgcaagcagctctgggacacagcaaacgctgtgaaggagaaattt
gggaagaagctctatgagtctctcttagtagggaacctcccagacatgaacaagatgctg
gacaaggaggatttcactatgatgaaaagggccatttttgccacacagcgtcactccttc
ccccccatatgcactcacaatatgctggacgactccacggaccccatcctgaacacgatc
cggcgcattgggctcttcaacagcagtgccgaccgtgtcaaggtcatcttccaccctgag
ttcctctcctccaccagtcctctgctacctgtggactatgaagagtttgtccgtgggtgt
cacttaggtgtcttcccctcctactatgagccctggggatacacaccagctgagtgtact
gtcatggggatccccagtatctccaccaacctctcaggatttggctgcttcatggaagag
cacattgcagacccctctgcatatgggatctatatcctggatcggcggttccgctcactg
gatgactcatgcacccagctgacctccttcctgtacagcttctgccagcagagccgacgc
cagcgcatcatccagcgcaaccgcaccgagcgcctctccgacttgctcgactggaagtac
ctgggccgggtctccctaactgatgcctccctctctctttctctgcccttcccannggcc
cagggcttccgctacccccgcccagcctcagtgcccccatctccctccatctcccgccac
tccagcccccaccacagtgagacagaagaggatgacgagcgctacgatgaggatgaggag
gcggagaaggaccgccagaacatcaagccacctgccaccatgggccctgtccctgactgg
cgcaagcagcccaaaaagctgtccagtgaggccagcacctcctccaatgccagcactccc
accctgcccagcagccccagtgacctcagcagccctggcagctccatcattgaggaacga
aactag

DBGET integrated database retrieval system