KEGG   Alligator sinensis (Chinese alligator): 102373175Help
Entry
102373175         CDS       T02922                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
asn  Alligator sinensis (Chinese alligator)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 664 aa AA seqDB search
MTKQRVLQVSPLHPRNAICVVGTEVFLDIRRSIPRGATSFDVHGTSGVRVYIIYNHDFVK
EPMSETRWPLDANIEITITMDFPSETVNDNKVRISYYGENGNEPIETAWLYLTCVSVSLD
TDTNRTGVVESSEAEKTKWTWGPDGHGAVLLVNCDRDSLGSGGTDNTHPRVQSYADLQDM
SIMILRTQGPSALFAENKLVLQVPASEADKVRVFHAAGNDSYYQYKPVLGPDKLSYAVDH
ASRQEITFYVEGLAFPDQDFSGLVSFSVMLLEVSNEGFPDTPIFTDTVVFRVSPWIMTPN
TLQPLEVFVCSIESGANPNVDFLSAMSALVRKANCKLTVCPQLENRSDRWIQDELEFGYV
EAPHKLFPVVFDSPRNRGLQNFPLRRILGPDFGYVTREPPKSQVSGLDSFGNLDVSPPVT
VQGKEYPLGRILIGSSFPRSGGRRMAKVIRDFLYAQAVQPPVEVYSDWLTVGHVDEFLTF
VPASDRKGFRLLLGSPRACYQLFEEKQQQGHGDAAQFTGLAGMAIITIDEILANETLRRS
NRYAQNCIDWNRKILKQELGLSEEDIIDIPQLFVLRNSFADAFFPNLVNLVVLGTHLGIP
KPFGPIVDGQCCLEEKVRSLLEPLGLTCTFINDFFSYFELEGDVHCGTNVLRKPFSFQWW
NMIP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaacgagtcctacaggtatcccctttgcacccaagaaatgccatctgtgtg
gtgggcacagaggtcttcctagacatacgcagatccatcccaaggggtgccacatcattt
gacgtccatggtacctccggagtcagggtctacattatttataaccatgactttgtgaag
gaacctatgagcgaaacacgatggcctctggatgctaacatagagatcacaatcaccatg
gactttccaagcgagaccgtcaatgataataaggttaggatttcatactatggagagaac
ggcaatgaacctatagagaccgcttggttgtacctcacctgtgtcagtgtttctctggac
accgacacaaaccgcaccggggtggtggagagcagtgaagcagagaagacaaaatggaca
tggggccctgatgggcacggagccgtgctgttagtgaactgtgacagggacagcctgggc
tccgggggcacggacaacactcacccacgcgtgcaatcctacgcagatcttcaggatatg
tcaattatgatactgcgaacgcaaggccccagtgccctttttgctgaaaacaaattggtt
cttcaggtccccgcgtctgaggctgataaagtgagagttttccatgctgccggcaatgac
tcctactaccagtacaagcccgttctgggaccagacaagctctcctatgcagtggaccat
gccagcagacaggagattaccttctatgtagagggactggccttcccagaccaggacttc
tctgggctggtttccttcagtgtcatgctgctagaggtctccaatgagggttttccagac
actccaattttcacagacacggtggtcttccgggtgtccccgtggataatgacgccaaac
acgctgcagcctctggaggtttttgtctgcagcatcgagagtggtgcaaaccctaatgtg
gacttcctgagtgccatgagcgccctggtgaggaaagccaactgcaagctgaccgtctgc
cctcagctggaaaaccggagtgaccgatggatccaggatgagctggagtttggctacgtg
gaagccccccacaaattattccctgtggtctttgactctcctagaaaccgaggcctgcag
aattttcccctgcggaggattttgggccccgattttggctatgtgacccgagagcctccc
aaaagtcaggtgtccggcctcgattcctttgggaacctggacgtcagccctcccgtgacg
gtccaagggaaggaatatcccttggggaggatccttattggaagcagcttccccaggtct
ggcggcaggaggatggcgaaggtgatccgagacttcctctacgcccaggcggtgcagccc
ccggtggaggtctactcagactggctgaccgtgggacacgtggacgagttcctgactttt
gtcccagcctccgataggaagggtttccggctgctcttaggcagtcccagagcctgctac
cagctgttcgaggagaagcagcaacagggtcatggagacgccgctcagttcactgggctg
gcgggtatggcgataataacaatagatgagatcctggctaatgagactctgaggaggagc
aatagatatgcacagaactgcattgactggaatcgaaaaatcctgaagcaggagctggga
ctgagcgaggaagacatcatcgacatcccacagctgtttgtgctgagaaactcctttgca
gatgccttcttcccaaacctggtgaacttggtcgtcttggggacacacctgggcatcccc
aagccttttgggcccatcgtcgacgggcagtgctgcctggaagagaaggtccgctccttg
ctggagccgctgggcctgacctgcaccttcatcaatgacttcttctcctactttgagctg
gaaggggatgtccactgcggcaccaacgtcctccgtaaacccttctccttccagtggtgg
aacatgatcccctga

DBGET integrated database retrieval system