KEGG   Alligator sinensis (Chinese alligator): 102373489Help
Entry
102373489         CDS       T02922                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:asn00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:asn00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 428 aa AA seqDB search
MVHIHILKKSMCVLLLVLVLLTICLWNETRKNYYVPLKTESESFPMPGALEKFNRLNSRS
LSNDAVHEKNPTPDILPDNLNKVKGNILEKDKGNDAVAKLKTPASSVKVWNENSSSKNLI
PRLQKVRNNYLSMNKYNVTYRGKRNAVKVNSEKLLCQLRDKVNVTMIQGLDGPFNTSEWH
NYLPRKKLSDATGRLGRCAVVSSAGSLKSSHLGPEIDGHDAVLRFNGAPTKGXXXXXXXX
XXDVGEKTTVRLVNSQLVTVEEHNFLTESLYNTGILIVWDPAPYHAEIHEWYRKLDYNFL
ETYKKYRSQHPEQLFYILNPKMEWELWDILQENSLEDIQPNPPSSGMLGIIIMMTICDEV
NVYEFIPSKRQTDICHYYQKFHDRACTMGAYHPLMFEKNLVKYLNQGTDYNIYAHGKVTL
PGFRNLRC
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatccatatattgaaaaaatcaatgtgtgtactcttgctagtactcgtgctt
ctgacaatttgcttgtggaatgaaacaagaaagaattactatgttcccctcaaaacagaa
agtgaaagctttccgatgcctggggctctggaaaaattcaatagacttaattcacgaagt
ctttcaaatgatgctgtccatgagaagaacccaacacctgacatcttgccagacaacctg
aataaagtaaaagggaacatcttggaaaaggataaaggaaatgatgcagtggccaagctc
aagactccagcgagctctgtgaaggtctggaatgagaacagttcatcaaagaatctcata
cctaggctgcaaaaagtcagaaataattacctctccatgaacaagtataatgtgacttat
cgtgggaaaaggaatgctgttaaagtcaattcagagaagctgctgtgccagctccgggac
aaagtgaatgtgaccatgatacaagggttggacggtccgttcaatacctctgaatggcat
aactacctaccaagaaaaaaactcagtgacgcaacgggccgcttgggtcgttgtgctgtt
gtgtcctcagcgggatctttgaagtcctcacacttggggccagaaatagatggccatgat
gcagttttgagatttaatggggcccctaccaaaggnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnggatgtaggagaaaagacaaccgttcgtcttgttaactcccagcttgtgactgtt
gaggagcacaacttccttacagaaagcttgtacaatactgggattttaattgtctgggat
ccagcaccataccatgcagaaattcatgagtggtatagaaaacttgactacaattttttg
gaaacctataagaagtatcgcagtcagcatcctgagcaactcttttatatactgaaccca
aagatggaatgggagctctgggatattctgcaagagaactccttggaggacatccagcct
aatccaccttcttcaggaatgcttggtattataattatgatgactatttgtgatgaagtg
aatgtttatgaattcatcccttctaaacggcagacggacatttgccactactaccagaag
ttccatgaccgtgcgtgtaccatgggggcctatcacccactgatgtttgagaaaaacttg
gtgaagtacctaaatcaaggcacagactataacatttatgctcatgggaaagtaacttta
cccggcttcagaaatttgcgttgttag

DBGET integrated database retrieval system