KEGG   Alligator sinensis (Chinese alligator): 102373766Help
Entry
102373766         CDS       T02922                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102373766 (POMT2)
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     102373766 (POMT2)
Glycosyltransferases [BR:asn01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102373766 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 743 aa AA seqDB search
MPPALRGSQAEPGPRCEALRKRESRAPAEGRSCRPDPAPALAALGGVGGGWAALAFVTLL
GFASRFYRLQQPPHVCWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTF
PFQKPGDRYEQHNYIGMRGFCAFLGSCLVPFVYLTVLELSKSLPAALLSAFILIFDTGCI
TLSQYILLDPILMFFIMAAVLSMVKYNSCADRPFSLPWWFWLSLTGVNLAGAMGVKFVGL
FVVILVGLNTISDLWDLLGDLSLSLVMFGKHLLARVLCLILLPLALYMALFAVHFAVLNK
SGPGDGFYSSAFQSRLIGNNLHDVSIPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGVG
ARQQQVTAYLHKDLNNLWIIKKYDSNADHLDPSCTVEFVRHGDIIRLEHKETSRNLHSHQ
HEAPLTRKHFQVTGYGINGTGDSNDFWRIEVVGRKSGKLIKVLRSQIRLTHVATGCILGS
SGKMLPKWGWEQVEVTCTPYLKENPSSLWNIEDHINPKLPNISLDVLKPSFTEILLESHM
VMIRGNSGLKPKENEVTSKPWHWPINYQGLRFSGINETDYRVYLLGNPVVWWLNLVTIGV
YFLMTTSTAVAMKRGVQQMTEHRELFQVLLRGGGQIMLGWLLHYLPFYMMGRVLYFHHYF
PAMLFSSMLTGITWDTLLKFCTGHLLSSTMARRVYTCGVLTLVLLIVYSFYLFHPLSYGM
VGPMASDPNSSMAGLRWLESWEF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggcgctgcggggcagccaggccgagccgggcccacgctgcgaggcgctgagg
aagcgggagtcccgcgcgccggccgaggggcggagctgccgccctgatcccgcgcccgct
ttggccgccctaggcggtgtgggcggagggtgggccgcgctggccttcgtcaccctcctg
ggcttcgcctcccgtttctaccgcctgcagcagccgcctcacgtctgttgggatgaaact
cattttggcaagatgggaagttactacattaaccggaccttcttctttgatgtccaccca
cccctgggaaagatgctaataggactcgctggttatctgagtgggtatgatggcacattt
cctttccaaaaaccaggggacagatatgagcagcataactacattggcatgagagggttc
tgtgcattccttggttcctgcctggttccctttgtctacctcacagtgctggaactgtcc
aagtcattgccagcagcattgctgtcagctttcatcctgatttttgatacaggttgcatt
acactgtcccagtatattctgcttgatcccatcttgatgtttttcatcatggcagctgtg
ctgagtatggtcaaatataactcctgtgcagatcggcccttctctctcccttggtggttc
tggctgagtctgactggggtgaaccttgctggagcgatgggggtgaagtttgttggcctc
tttgtagtgatcttggttggactgaacacgatttctgacctgtgggatttgctgggggac
ctcagcctgtcactggtcatgtttgggaaacacttgctggcacgagtgctctgcctcatc
ctgctgcctcttgccctttacatggctctgtttgctgttcattttgcagtattaaataaa
agtggacctggtgatggcttctacagctctgcctttcagtcccggctgattgggaacaat
cttcacgatgtctccattccagagcatctggcatatggctctgttgtcacaatgaagaac
ctgcgaatggcaggggggtatcttcattcacactggcacctgtaccctgaaggagtggga
gcacgtcagcagcaggtcactgcctatttacacaaggacttgaacaacctgtggattata
aagaaatacgattcgaacgcagatcatttggacccgtcttgtactgtggagtttgtgaga
catggagatataattcggctggaacacaaagagacttccagaaatcttcatagtcaccag
catgaggcccccttgacaaggaaacactttcaagtcactggatatggaataaatggaaca
ggagactccaacgatttctggaggattgaggtggtgggcaggaagtctgggaaactcatc
aaagtcctacgaagtcaaatccgactgacccatgtggccacagggtgtatattgggctcc
tctgggaagatgcttccaaaatggggctgggaacaggtggaagtcacttgcactccgtat
ctgaaggagaatcccagttccctctggaacattgaagatcacatcaatcctaagttgcct
aatatcagcctggatgttttgaaaccgtccttcacagagattctgctggagtcccacatg
gttatgatccggggtaacagtggcctgaaaccaaaggagaatgaagtcacatccaaaccg
tggcactggcccatcaattaccagggcctgcgtttttctggcatcaatgagacagattat
cgggtttatttgctgggaaacccggtagtctggtggctgaatctagtcactatcggagtg
tacttcctaatgacaacttccaccgctgtggccatgaagaggggagttcagcaaatgact
gaacacagagagctcttccaagtcttattgcgaggtggagggcagattatgctgggttgg
ctccttcattacctccctttctacatgatgggcagagtcctttactttcatcattacttt
cctgcaatgcttttctccagcatgttgacaggaattacttgggatacactactgaaattc
tgcactgggcacttactgtccagcaccatggctcggagggtgtatacatgtggggtgctg
acactggtgctgctcattgtctacagcttctacctcttccatccattgtcctatgggatg
gtaggacccatggcctcagatcccaacagctcaatggcagggctgaggtggttggaatca
tgggaattctag

DBGET integrated database retrieval system