KEGG   Alligator sinensis (Chinese alligator): 102374793Help
Entry
102374793         CDS       T02922                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102374793 (SIRT6)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     102374793 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 102374793
NCBI-ProteinID: XP_006017656
UniProt: A0A1U7RGJ5
Position
Un
AA seq 346 aa AA seqDB search
MGSDCLKVTWMIFDPPEELERKVRELADLIRSSSNVVFHTGAGISTAAGIPDFRGPNGVW
TMEEKGLSPKFDTTFENAKPSKTHMALLELQRAGILKFLVSQNVDGLHVRSGFPRDKLSE
LHGNMFVEECVKCGKQYVRDTVVGSMGLKSTGRLCNVTKARGLRACRGKLIDTILDWEDS
LPGRDLSLADEACRKADLSITLGTSLQIKPSGNLPLITKKRGGKLVIVNLQATKHDRQAD
LRIHGYVDEVMMKLMKHLGLEIPEWRGPVVVERAELVKPEEPLKPDPDALCPAKAESPSH
HNGIMEGASGTCPGLGLVPKSRCDSVKQECPSPVAAKRRKAESLLT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgactgcctcaaggtcacttggatgatctttgatcctccggaggagctggag
aggaaagtgcgtgagctggccgacctgatcaggagctcttccaacgtggtgtttcacacc
ggggctgggatcagcacagccgcagggatccccgacttcagggggcccaatggcgtctgg
accatggaggaaaaggggttgtcccccaagttcgacaccacctttgagaatgccaagccc
tccaagacacacatggcactgctggagctgcagagagctggcatcctgaagttcctggtc
agccagaacgtggacgggctgcatgtccgctctggattcccacgggacaagctgtccgag
ctgcacgggaacatgtttgtggaggaatgtgtgaaatgcggcaagcagtacgtgcgggac
accgtggtggggagcatgggcctcaagtcgacaggcaggctgtgcaacgtcactaaagcg
cgtggtctccgtgcctgcaggggcaagctcatagacactattctggactgggaggattcg
ctacctggccgggacctcagcctggccgatgaagcctgcaggaaagcagacctgtcgatc
actctgggaacctctctccagatcaaacccagtggcaatctccccctgatcacgaaaaag
agaggtgggaagctggtgattgtcaatctccaagcaaccaaacacgacagacaagccgac
ctgcgcatccatggctatgtggatgaagtcatgatgaagctgatgaagcacctgggtctg
gagatccctgagtggagagggccagtggtagtggagagggcagagctggtgaagcccgaa
gagcccctcaagcccgaccctgatgctctttgtccagccaaagctgagtccccttcccac
cacaacggcatcatggagggggccagcgggacctgccctggcctggggctcgtgcccaag
tctcgctgtgacagtgtgaaacaggaatgtcccagccctgtagcagccaagaggaggaaa
gcagagtcactgctcacctga

DBGET integrated database retrieval system