KEGG   Alligator sinensis (Chinese alligator): 102375151Help
Entry
102375151         CDS       T02922                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102375151 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1487 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTLAQSNEKRRREQENKYLEELAELLSANIGDIDTL
SVKPDKCKILKKTVDQIQQMKRLEQEKAADDDVQKSDISSSSQGVIEKESLGPLLLEALD
GFFFVVNREGRIVFVSENVTGYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGV
PWPQEATRRNSHTFSCRMLIRPPDEPGAENQEARQRYEVMQCFTVSQPKSIKEEGEDFQS
CLICIARRLPRPTAVTSTESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQ
PQGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPQSPEMQPFIMGI
HIIDRDHGMLSPPENANSAMPLPRVSPSLNPSISPGQGMALPPTIPPSNGSMLATNVNQQ
PGSGLHSSNSTTSQPSFGCSPGSQIGANVALSQGQAGPQNSNHTLNLNSSPMGSPGMTPP
QFMSPRHRVSPGLVPRPRAPNNPFSPTMPTMHSPVGMTGSGCSSGGGAGGSGSRPYPSAP
MNSMQGLGDSPSTPMGYSTPPPVLRQMSNQNSPGRLAMQPMKTESKDSKEIASILSEMIQ
SDSGSGDSKPLDSAMLHASDRLSEGDAKGAQATSHKLVLLLASTAEQQLRHADADTSCKD
PLSCAGAMGTPASGNPPSSTCPSSHSSLTERHKILHRLLQEGSPSDITTLSMEHDKKENV
PSTPTAPTTQSQIPGTPEIKLEPEALKKKDIKDHQLLRYLLDKDEKELAAAPALSLDDVK
VKVEKTEQMDPCNTTPAPLTKPTAVEEVKLENQGQGPGCGLVVPSRRLPQSPGSLPQQGW
SSCYALVEARRCSFAADLDQLDQLLPSLEKAAQMPGLCGPDRTESGVAIKPEMMAAPLQA
SSTARTPTGLNRISELELGVPDHQFGQPGMGDQLPWTDNTMASMNRGPLNKPEDQCITSQ
LDELLCPPTTPEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLEALTER
FQPQQVTPPLLMDQKPGMYPQPYSSAPTANLPGPFPGMVRQKPSFGPMPVQVPPPRGAFP
TNMGMQPRQTLNRPPTAPNQLRLQLQQRLQGQQQLIHQNRQAILNQFAASSPVGINMRAG
MQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLMQQRALLMRQQSFGNNLPPSAGLPVQI
GAARLPQAPPQQFPYPPNYGTSPGNPPTSTSPFSQLASNPEVALANRNNMVNRSMMGSVG
GQFGAGMTPQMQQNLFQYSGSGMGQQNEPGFAPALSPSSPLMSPQIPPSQSPMLQAAPPT
PGYQSPDMKTWQQGTMGNNNVFSQAGQNQPAPAQQGMYNNVSITVSMAGGNTNVQNMNPM
AGQMQMNSLQMPGMNSMCSEQVNDPALRPAGLYCNQLSSTDLLKTEADGAQQVQQVQVFA
DVQCTVNLVGGDPYLNQPGPVGSQKNASGPQTTQAQQKSLLQQLLTE
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagctcaacggaccctgctaacccggactcccgcaaaaggaag
gggtctccgtgcgacacgttggcccagagcaatgagaagcggcgccgggagcaggagaac
aagtacttggaggagctggcagagctgctgtcagcaaacatcggggacatcgacaccctg
agcgtcaaaccagacaaatgcaagatcctgaaaaagacagtcgaccagatccagcagatg
aagagattggaacaagagaaggcagctgacgacgatgtccagaagtctgacatctcctcc
agcagccaaggagtgatcgagaaggaatccctggggcctcttctcctggaggcgctggat
ggcttcttcttcgtcgtgaaccgggaagggaggatcgtgttcgtgtccgagaacgtgacc
ggctacctgggctacaaccaggaggagctcatgaacaccagcgtctacagcatcctgcac
gtgggggatcacgccgagttcgtcaagaacctgctgcccaagtctctagtgaacggagtt
ccttggcctcaagaggcgacccggcgcaacagccacaccttcagctgcagaatgctgatc
cggccccccgacgagccgggcgccgagaaccaggaggcccgccaacgctacgaggtgatg
cagtgcttcacagtgtcccagcccaaatccatcaaagaggaaggagaagatttccagtcg
tgtctgatatgcatcgcacggagattacctcgacccacagctgtcaccagtacagagtcg
ttcgtgaccaagcaagatactacaggtaaaatcatctccatcgacaccagctccctgcga
gcggcaggcaggactggctgggaggacctggtgcggaagtgcatctacgcattcttccag
cctcagggcagagagccgtcatatgccaagcagctattccaagaagtgatgacccgcggc
acggctttcagtccatcctacaggtttacgctgagcgacgggacggtgctgagcgcccac
accaagtgtaagctctgctacccccagagtcctgagatgcagcccttcatcatgggcata
cacatcatcgacagggatcacggcatgctttctcctccagagaacgcgaactccgccatg
ccccttccgcgggtcagcccctcgctgaaccccagcatctccccggggcaaggcatggcc
ctgccgcccaccatccctccatccaacggcagcatgttggcaaccaacgtgaaccagcag
ccaggctctggcctccacagcagcaattccaccaccagccagccgagctttgggtgttcc
cctgggagccagataggagccaacgttgccttaagccagggacaggcgggtccccagaac
agtaaccacactttgaacctcaacagctcgcctatgggcagccctggcatgacaccaccg
cagttcatgtctcccaggcatcgggttagcccaggactggtcccacgtcccagagcgccc
aacaaccctttctctcctaccatgcccaccatgcactcccccgtgggcatgaccggcagc
ggctgcagcagcggtggaggtgcaggtggcagcggcagccggccctaccccagcgctcca
atgaactctatgcaggggcttggcgacagccccagcacccccatgggctactccacgcca
ccgcctgtcctgcggcagatgagcaaccagaactcacccgggcgccttgccatgcagccc
atgaaaacggagtcgaaggacagcaaggagatcgcctctatcctgagtgagatgatccaa
tccgacagcggctccggggacagcaagcctctggactcggccatgcttcacgccagtgac
aggctctcggagggcgatgccaagggcgcccaggccaccagccacaagctggtcctgctc
ttggccagcacagctgagcagcagctgcggcatgccgatgccgacactagctgcaaagat
cccttgtcctgtgcaggggccatggggaccccggcatccgggaaccctccaagcagcaca
tgtccctcctcccacagctcgctgacggaacggcacaagatcttgcatcggctcctgcag
gaaggcagcccctccgacatcaccaccttgtccatggagcacgacaagaaggagaatgtg
cccagcacacccaccgcccccaccacacagagtcagatcccaggcacacctgagatcaaa
ctggagccagaggccttgaagaaaaaggacatcaaggatcatcagctcctgcgctacctg
ctggacaaggacgagaaggagctggctgctgccccggccctgagcctggacgatgtgaag
gtgaaagtggagaagacggagcagatggacccatgcaatacgacgccagctccgctgacc
aaacctacagctgtggaggaagtgaagctggaaaatcaaggccagggtcctggctgtggg
ctggtcgtgccttctagacggctgccccagtctcctggctcgctccctcaacagggctgg
agcagctgttacgccttggtggaagccaggagatgctcgtttgccgccgaccttgaccag
ctcgaccagctgctgccatcgctggagaaggcggcgcaaatgccgggcctgtgcgggcca
gacagaaccgagagtggcgtggcaatcaaacccgagatgatggcagctccgctccaggcc
agcagcacggcaaggacccccacgggtctcaatcgaatatccgagctggaattgggagtt
ccagatcaccagtttgggcagccaggaatgggcgaccagcttccgtggacagacaacacc
atggcctccatgaatcgaggaccgttgaacaaaccagaagaccagtgcatcacttcccag
ctggacgagctgctgtgccctcccacgacgcccgagggccgaaacgacgagaaagccctc
ctcgagcagctcgtgtccttcctgagcggcaaggacgagacggagctggcggagctggat
cgagcgctggggattgacaagctggtccagggaggggggctggaagcactgacggagaga
ttccagccccagcaagtgacgccgcctctcctcatggatcagaagcccggcatgtatccc
cagccttactcctccgctcccaccgccaacctccccggccccttcccgggcatggtccgg
cagaaaccttcctttgggccgatgcccgtccaggtacctccgccccgaggggctttcccc
accaacatgggcatgcagccgcggcaaaccctcaacaggcccccgacggctcccaaccag
ctgagactccagctgcagcagcggctgcaggggcagcaacagttgatacaccagaaccgg
caggccatcctgaaccagtttgcagccagttccccggtcggcatcaacatgagggcaggc
atgcagcagcagatcacgccgcagccacctctgaatgcccagatgctggcccagcgccag
cgagagctgtacagccagcagcaccggcagaggcagctcatgcagcagcgcgccctcctg
atgagacagcagagctttgggaacaacctcccgccctcagccggcctcccggtgcagatc
ggggctgcccgcctcccccaagcgcccccacagcagttcccctaccctccgaactacggt
acgagccctgggaacccgcccacgtccaccagccccttctcacagctggcatcgaaccct
gaggtggcgctggccaatcgcaacaacatggtgaaccggagcatgatgggcagcgtcggg
gggcagttcggcgctgggatgaccccacagatgcagcagaacctcttccagtattcagga
tcgggcatgggccagcaaaacgagcccggcttcgcccccgcgctcagccccagcagcccg
ctgatgtcgccgcagatccctccttcccagagccccatgctgcaggcagccccgccgacc
cccgggtaccagtccccggacatgaagacctggcagcaaggaacgatggggaataacaac
gttttcagccaagcagggcagaaccagccggcgcccgcccagcaggggatgtacaacaac
gtgagcatcaccgtgtccatggcaggagggaacaccaacgtccagaacatgaaccccatg
gccggacagatgcagatgaactcactgcagatgcccgggatgaactccatgtgctccgag
caggtaaatgacccggcgctgagacccgcgggcctttactgcaaccagctttcctccact
gaccttttgaaaacagaagcagacggggcgcagcaggtacagcaggttcaggtgttcgcg
gatgtgcagtgtacagtgaatctggtaggcggagacccttacctgaatcagcctggtccc
gtgggctcccagaaaaacgcatcgggtcctcagaccacgcaggcccaacagaagagcctc
cttcagcagctactgactgaataa

DBGET integrated database retrieval system