KEGG   Alligator sinensis (Chinese alligator): 102375480Help
Entry
102375480         CDS       T02922                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102375480
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102375480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 512 aa AA seqDB search
MRILFLLATVALGWAQYNPNTRPGRTSIVHLFEWSWTDIALECERYLAPNGFGGVQISPP
SENVIITNPWRPWWERYQPISYKLCSRSGNEDEFIDMVTRCNNVSVHIYVDAVINHMCAS
GLGSENNATCGSYFNAKTRDFPAVPYSGWDFNDGKCKTGSGGIDNYGDLEQVRDCRLVSL
LDLALEKDYVRSKIAEYMNYLIDIGVAGFRIDAAKHMWPGDMKAILDKLKDLNTDWFSLG
SRPFIYQEVIDLGGESIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLRNWGEGWA
FMPSDKALVFVDNHDNQRGHGAGGASVLTFWDPRQYKMATGFMLAHPYGFTRVMSSFRWP
RYFQNGKDINDWVGPPSFEDGTTKPVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQ
PFSNWWDNNSNQVAFGRGNKGFIVFNNDDWYLNVTLQTGLPAGTYCDVISGQKNDDYCTG
LEIDVANDGTANFQISNNDEDTFIAIHVDAKM
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctctttctgctagcaactgtagcacttggttgggcacaatataatccaaat
acaagacccgggaggacatctattgttcatctctttgaatggagttggaccgatattgct
cttgaatgtgaacgctacttagcgcctaatgggtttggtggagttcagatatctcctcca
agtgaaaatgttatcattactaatccatggagaccctggtgggaaagataccagccaatc
agctacaagctttgttcacgatctggtaatgaagatgaatttatagacatggtgaccaga
tgcaataacgttagtgttcatatttatgtggatgctgtaataaaccacatgtgtgcatct
ggtcttggctctgaaaacaatgcgacctgtggaagttatttcaatgcaaagacaagagat
tttcctgctgtgccgtactcaggctgggactttaatgatggcaaatgtaaaactggaagt
gggggcatcgacaattacggggatcttgaacaggtccgtgactgccgcctggttagtctt
cttgatcttgcactggagaaagactatgtacgttcaaagattgctgaatacatgaactac
cttattgatattggtgtagcaggcttcagaattgatgctgccaagcacatgtggcctggg
gacatgaaggcaattttagataaactgaaagatttaaatactgattggttttctctagga
tcgagacctttcatttaccaagaggtaattgacttaggtggagaatcaatcaaaagcagc
gagtactttggaaatggccgagtgactgaattcaaatatggtgcaaaattggggacagtc
atacggaaatggaatggagaaaagatggcttatttaaggaactggggagaaggctgggcg
tttatgccttctgataaagcacttgtctttgtggataatcatgacaaccagagaggacat
ggtgcaggtggagcctctgttttaactttctgggatcccagacaatataaaatggcgacg
ggcttcatgcttgcccatccttatggatttacacgtgtgatgtcaagttttcggtggcca
agatatttccagaatggaaaggatattaatgattgggtgggaccaccaagctttgaggat
ggaacaaccaaacctgttacaattaatccagataccacttgtggaaatgactgggtctgt
gaacatagatggcgccaaataaggaacatggttattttccgaaatgtggttgatggacaa
cctttctccaactggtgggacaataatagcaatcaagtggcctttggacgtggaaataaa
ggatttattgtcttcaataatgatgactggtacttgaatgtaacactgcaaactggcctt
cctgctggcacttactgtgatgttatttctggacaaaagaatgatgactactgcactgga
ttagaaattgatgttgctaatgatggcacagctaatttccagattagtaataatgacgaa
gatacttttattgccattcacgtggatgcaaaaatgtaa

DBGET integrated database retrieval system