KEGG   Alligator sinensis (Chinese alligator): 102375827Help
Entry
102375827         CDS       T02922                                 

Gene name
MAOB
Definition
(RefSeq) amine oxidase [flavin-containing] B
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102375827 (MAOB)
   00330 Arginine and proline metabolism
    102375827 (MAOB)
   00340 Histidine metabolism
    102375827 (MAOB)
   00350 Tyrosine metabolism
    102375827 (MAOB)
   00360 Phenylalanine metabolism
    102375827 (MAOB)
   00380 Tryptophan metabolism
    102375827 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102375827 (MAOB)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102375827 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 643 aa AA seqDB search
MTAARRHHRKITGPWNGSPGYERPVVEKLIYSSQCKEIKAINLEVKSVMASAVIVRTHFA
SNTDPQILPPINQFGKSNCAGVGTIQNFMGNFYLSGSEVITGEEAKAQNGDMTCPKSPSK
TVAELGIEPKCPESQPSGLSAAKLLAESGLSVIVLEARDRVGGRTFTARNKQVKYVDLGG
AYVGPTQNRVLRLSKELGLETYKVNEVEHLIHHVKGKSYPFKGPFPPMWNPFVYLDFNNL
WRTMDEMGKEIPNEAPWKAPHAEEWDKMTMQEFIDKICWTNAAKRFVTLFVNVDVTSEPH
EVSALWFLWYVKQCGGTGRIFSTTNGGQERKFVGGSGQISEKIMERLGNRVKLERPVVHI
DQSHENVIVETLNHEIYEGKYVISAIPPVLGLKIHYNPPLPPMRNQLINRVPMGAVIKAI
VYYKDTFWRKKGYCGTMIIDDEDAAIGLTLDDTKPDGSVPAIIGFILSRKCRRLTHLTKE
ERKKRLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRILRQPV
GRIYFAGTETATEWSGYMEGAVQAGERAAREILCSMGEISEGEIWKSEPESIDVPALPIT
TTFWERNLPSIPGLLKLVGLSTFFTSVAALGLFTCKKGLLVRN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcccgtcgccatcacaggaagataactggtccatggaatggttctcctggg
tatgaaagaccagttgtggagaagctgatctacagctctcaatgcaaagaaataaaagca
ataaatcttgaggtgaagtcagtaatggcttcagctgttatagtaagaacacacttcgct
tcaaatactgatccacagatcttacctccaatcaaccaatttggaaagtctaattgtgct
ggagttggcactattcaaaactttatgggaaatttttatttgagtggatcagaagtaata
acaggtgaagaagctaaagcacagaatggggacatgacttgtccaaagtcacccagcaag
acagtggcagaactgggaatagaacccaaatgtcctgagtctcagcccagtggtctgtca
gcagccaagttgctggctgagtctgggctgagtgtcattgtattggaagcccgggacagg
gtcggaggaagaactttcactgcaaggaataagcaagttaaatatgtggaccttggagga
gcatatgtgggaccaacacaaaatcgtgttctgcggttgtccaaagaactaggattagag
acgtataaagtgaatgaagtagaacatcttattcaccatgtcaagggtaaatcttatcca
tttaagggtccattcccgcctatgtggaacccatttgtctacttggattttaacaatcta
tggaggacaatggatgaaatgggaaaggagattcctaatgaagccccgtggaaagctcca
catgcagaagaatgggacaaaatgactatgcaagagttcatagacaaaatttgctggaca
aatgctgccaagcggttcgtgactttgtttgtgaatgtggatgtcacctctgagccccat
gaggtctctgctctttggttcctgtggtatgtgaagcagtgtgggggtacaggcaggata
ttctccacaaccaatggtggccaggagagaaagtttgttggaggctctggtcagattagt
gagaagataatggaacgattggggaaccgagtaaagctagagagaccagtagtccacatt
gatcagtcacatgaaaatgtcatagtggaaaccttaaaccatgagatttatgagggtaaa
tatgttattagtgccatccccccagttcttggcctgaagattcattacaatccaccatta
ccaccaatgagaaaccaattgattaaccgagttcctatgggtgcagtcattaaggccatt
gtgtactacaaagacactttctggaggaaaaaaggctactgtggtaccatgatcattgac
gatgaagatgctgcaattggtctaacacttgacgataccaaacctgatggcagtgttcct
gctataataggttttattctttctcggaagtgtagaagactgacacaccttacaaaggaa
gaaaggaagaagaggctgtgtgagctctatgcaaaagttttgggatcagaagaagcctta
catccagtgcattatgaagagaagaactggtgtgaggagcagtattctggagggtgctac
actgcatatttcccaccagggataatgactcagtatggaaggatccttcgccagccagtt
ggcaggatctactttgctggcacggagacagctacagagtggagtggatacatggagggg
gctgtgcaggctggagagagagcagctagagagatactgtgttctatgggagaaatctca
gaaggtgaaatttggaagtcagaaccagaatcgattgatgtcccagccctgccaatcact
actaccttttgggagagaaacttgccatctataccaggactactgaagctggttggatta
tctactttcttcacatcagtggctgctcttgggctgttcacatgcaagaaggggctgcta
gttcgaaactga

DBGET integrated database retrieval system