KEGG   Alligator sinensis (Chinese alligator): 102376351Help
Entry
102376351         CDS       T02922                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102376351
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102376351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
MAFLWILPCLAFISTAWAGCGTPAIQPIISGYARIVNGEEAIPGSWPWQVSLQDNTGFHF
CGGSLISEDWVVTAAHCGVKTTDRVVLGAFDLGFLGEDVQVLKIAQVFKNHNFNMLTLRD
DITLLKLATPAKMTARVSPVCLPEATDYFPGGITCVTTGWGLTNPNAQKTPEKLQQVALP
LLTNAQCKSYWSYRIKDCMVCAGAKGASSCMGDSGGPLVCQKDGIWTLVGIVSWGSNTCS
PSSPGVYTRVSKLRPWINEIIAAN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggatcctgccctgtctggccttcatcagcaccgcctgggcaggctgc
ggcacccctgccattcagccaatcatcagtggctacgcccggattgtgaatggtgaggag
gcgatccctggttcctggccctggcaagtctccctgcaggataacactggattccatttc
tgtggcggctccctgatcagtgaagactgggtggtgactgcagcccactgtggggtcaag
acaactgaccgtgtggtgctgggtgcatttgacctgggctttctaggagaggatgtgcaa
gtcctgaaaattgcccaggttttcaagaaccacaatttcaacatgctcacgctcagagat
gacatcactctgctgaaactggccactccagccaaaatgacggcccgtgtgtctcctgtg
tgcctgcctgaagccaccgactacttccctggaggcataacctgtgtcaccacagggtgg
ggcctgaccaaccccaatgctcagaagacccctgagaagctgcagcaggtggcccttcca
ctcctgactaatgcacagtgcaagtcatactggagctacaggattaaggattgcatggtc
tgcgcaggtgccaagggagcctcctcctgcatgggtgactctggtggccccctggtgtgc
cagaaggatggcatctggaccctggtggggatcgtctcttggggaagcaatacctgctcc
ccctccagccccggcgtttacactcgtgtctccaagctcaggccctggatcaatgagatc
atagcagccaattaa

DBGET integrated database retrieval system