KEGG   Alligator sinensis (Chinese alligator): 102376804Help
Entry
102376804         CDS       T02922                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102376804 (ELP3)
Transfer RNA biogenesis [BR:asn03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102376804 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 558 aa AA seqDB search
MEVRGASARCNMRQKKKGALSRAELMMMTIADIIQQLVEAHEQGKDVNLNKLKTKTSAKY
RLSAQPRLVDIIAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNIC
VYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQARHRVEQLKQLGHSVDKVEFIV
MGGTFMALPEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSLTKCIGITIETRPDYCLK
RHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDL
PNMGLERDIDQFVEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYPPSTLVDLV
ARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQ
EIHHKVRPYQIELVRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSEESFRPELKGGV
SIVRELHVYGSVVPVSSRDPSKFQHQGFGMLLMEEAERIAKEEHGARKIAVISGVGTRNY
YRKIGYELEGPYMVKKLD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgcgcggcgcttcggcccgctgcaacatgaggcagaagaagaaaggagccctc
agccgggcggagctgatgatgatgaccatcgccgacatcatccagcagctggtcgaggcg
cacgagcagggcaaagatgtcaacctgaacaagctgaaaaccaagacatctgctaagtac
agactctcagcacagcctcgtttggttgacatcattgctgcagttccacctcagtaccgc
aaggtgctggtacccaaactgaaggcaaagcctattcgaactgctagtgggatcgctgtt
gttgctgtgatgtgcaaaccacacagatgtccacacattaactttacaggaaacatatgt
gtgtactgccccggtgggcctgattctgattttgaatattcaacacagtcttacactgga
tatgagccaacatcaatgagggccattcgtgccaggtatgacccttatctccaggcgagg
catcgagttgaacagctgaagcagctgggccacagtgtggataaagtggagttcattgtg
atgggaggaacattcatggcccttcctgaagactatagagactacttcatccgaaatctg
cacgatgctttatcggggcacacttccaacaacgtagctgaggctgtcagatattcagaa
cggagcctcacaaagtgcattgggatcacaatcgagaccaggcctgattactgcctgaag
cgtcacctgagtgacatgctgtcatatggctgcacaaggctggaaatcggtgtgcaaagc
gtgtacgaggatgtggccagagatacaaacaggggccacaccgtgaaggccgtatgcgag
tcatttcacttggccaaggacgccgggtttaaagtggtggcacacatgatgcccgacttg
ccgaacatgggcctggaaagggacatcgaccagtttgttgagttttttgagaacccggct
tttcgcccagatggtctgaaactctacccaactctggtgatccgtgggactggcctgtac
gagctctggaagtcgggaagatataagagttaccctccaagcaccctagtggatttggtg
gctaggatcctggctcttgtaccaccgtggacacgagtgtaccgggttcagagggacatc
ccaatgcctctagtcagttcaggtgtggagcatggtaacctgagagaacttgccttggcc
aggatgaaggatcttgggacacagtgccgtgacgtgaggacaagagaggttggaatacaa
gagattcaccataaagtgagaccatatcagattgaattagttcgaagagattacgtggct
aatggtggctgggagaccttcctgtcttatgaagacccagagcaggatattctggttggc
cttctgcgactgcggaagtgttcagaggagtcgttcagacctgagctgaagggaggtgtt
tccatcgttcgagagctgcacgtctacggcagcgtggttccagtgagcagtcgggatcct
tccaaatttcagcatcagggatttggtatgttgctgatggaggaagcagaacggatagcc
aaagaggagcacggcgcacggaaaattgctgtcatttcaggtgttggcactaggaattac
tacaggaagatcggctacgagctggaagggccgtacatggtgaaaaagctggactga

DBGET integrated database retrieval system