KEGG   Alligator sinensis (Chinese alligator): 102377205Help
Entry
102377205         CDS       T02922                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102377205 (ART1)
Cellular antigens [BR:asn04090]
 Proteins
  102377205 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 315 aa AA seqDB search
MHTVKMDVCRPVFILLLAGILADRPQVLAFPLHRRDLFPIKDVRLDMAPSAFDDQYKGCV
AMMEAELGALNSSEFSSNRVYAEAWTEAAAKWKEKQAETPVPPDLKAEHAIAIMAYTMQG
PLHRDFNAAVREAGRTRENYLGSFNFKTLHFLLTRGLQALGDTQHPRCRKVYRGVKGVRF
LSERRQTVRFGHFTSSSLRNTSALQFGQDTFFCIQTCHGAGIRNFSIFPSEDEVLIPPFE
TFTVKNFTRAGHRTLIELGSLDKSSSYNCEFVKEKRCKTQRCTFSSAAGASSASWSLFLL
WSFLVAASTQVALPS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcacacggtgaagatggatgtctgcaggccggtctttatcctgctgctggctgggatc
ctggcagaccgccctcaggtcctggccttccccctccacaggagagacctcttccccatc
aaggacgtgaggctggacatggcacccagcgccttcgatgaccagtacaagggctgcgtt
gccatgatggaggccgagctcggggcgctgaacagctcggagttctccagcaaccgggtc
tacgccgaggcctggacggaggctgccgctaagtggaaggagaagcaggcggagaccccg
gtgcctccggacctcaaggcagagcatgccattgccatcatggcctacaccatgcaggga
cccctccacagggacttcaacgcggctgtgagggaggcaggccgcacgcgggaaaactac
ctgggcagcttcaacttcaaaaccttgcatttccttctcacacggggtctgcaagcactg
ggggacacgcagcacccccggtgccgcaaggtgtaccggggcgtgaagggggtgcggttc
ctgtccgagcggcgccagaccgtgcggttcggccacttcacatcgtcgtccctaaggaac
acaagcgccctgcagtttgggcaggacaccttcttctgcatccagacctgccacggcgcc
ggcatcaggaacttctccatattccccagcgaggatgaggtgctcatcccgcccttcgag
accttcacggtcaagaacttcacccgggccgggcacaggaccctgatcgagctgggctcc
ctcgacaagtccagctcctacaactgcgagttcgtcaaagagaaaagatgcaagacccag
agatgcacgttcagctcagcagcaggggcgagcagtgcatcctggagcctgttcctcctc
tggagcttcctcgtggcagccagcacccaggtcgctctgccgtcttaa

DBGET integrated database retrieval system