KEGG   Alligator sinensis (Chinese alligator): 102377598Help
Entry
102377598         CDS       T02922                                 

Definition
ecto-ADP-ribosyltransferase 5-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102377598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 452 aa AA seqDB search
MHDRSVPWERSMQGWVNGLQGLAGRPQKEARPAAQPHHQPRSESGWVPSLEGKPQPPPLR
PAGYFLDSLPAVCVETRGVQSPTAAGKASCTPISEVGGELHVGEARHRQRYGSQKAPARL
FPLLHSSTCWLCLRPLQVDGEMKRVALAVTFLWVLSCSQMPQVRSQKSLQMGMAPDSFDD
QYIGCTEEMEAAAPRLLQEERARHGLLDGMWTNLSAVWTEKKKGLHLPAGFRDVHGIALL
VYTDSVQPLYRDLNTAVREAGVSRDTYLRTFPFKALHYYLSRALQLLREDCGRTYRNQLY
RGVRSIRFNPPGAGPVRFGQFTSSSLDAAVSRSYGNATFFILHSCFGAHIEALSSFPFEK
EVLIPPGEVFAVSNVTRQGDGNVLVLHSTNRTCSHFNCAYLGGEKSPSCTDHSGSCCRLC
GEMRPWRLGGLVVLIHVGTWTLTTHSGLLWAL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatcgctctgtcccctgggagaggagcatgcagggctgggtcaacgggcttcaa
ggcctggcaggcagaccacaaaaagaggcacgtccggctgcccagccccaccaccagccc
cgcagtgagtcaggatgggtcccaagccttgaagggaaacctcagccgccccctctccgc
cccgccggctacttcctcgactctctgccagctgtttgtgtcgagacgcggggagtccag
agtccaactgcagccgggaaagcaagctgcacaccgatctccgaagtggggggagagctg
catgtgggagaagccaggcaccggcagcgttacggatcccagaaagccccagcgaggctg
tttcctctgttgcactcgtccacttgctggctctgcctccggcccttgcaggtggacggg
gaaatgaagagggtggcgctggccgtgacgtttctctgggtgctgagctgctcgcagatg
cctcaggtgagaagccagaagtccctgcagatggggatggcgcccgactccttcgatgac
cagtacatcgggtgcacggaggaaatggaggcggctgctccgcggctgctgcaggaggaa
agagccagacatgggctgctggacgggatgtggacgaacctgtcggccgtctggactgaa
aagaaaaaagggctgcatctgcctgcggggtttcgggacgtgcatggcatcgccctcctg
gtctacacggactccgtccagccgctttaccgggatctgaatacagcagtgcgagaggcg
ggggtgtcccgagacacctacctgcgcaccttccccttcaaggccctgcactattacctg
agcagagccttgcagctgctgcgggaggactgcgggcgcacgtaccgcaaccagctctac
cggggggtccgctccatccgcttcaacccacctggggcaggcccggtccggttcggacag
ttcacctcctcgtccctggacgccgcggtctctcggagctatggcaacgccacgttcttc
atcctgcactcctgcttcggggcccacatcgaggcactctccagcttccccttcgagaaa
gaggtgctgatcccccccggcgaggtgttcgccgtgtccaacgtcacccggcagggagac
ggcaacgtcttggtgctgcacagcaccaaccgcacctgcagccacttcaactgcgcctac
ctgggcggagagaagtccccatcctgcactgatcactcaggaagctgctgccggctgtgc
ggcgagatgcgtccgtggcggctggggggcctcgtcgtcctgatccacgtgggcacctgg
acattgaccacccactccgggctcctctgggctttgtaa

DBGET integrated database retrieval system