KEGG   Alligator sinensis (Chinese alligator): 102377633Help
Entry
102377633         CDS       T02922                                 

Gene name
PCSK1
Definition
proprotein convertase subtilisin/kexin type 1
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102377633 (PCSK1)
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S8: subtilisin family
   102377633 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGINQTSADL
HDECTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLAGNPGWKKNG
AGLMVNSRFGFGLLNAKALVDLADPKVWKSVPEKKEGIVKDNSFEPRLLRANGEVTIEIP
TKACEGQENSVASLEHVQFEATIEYSRRGDLHVTLTSPSGTSTVLLAERERDKSPNGFKN
WDFMSVHTWGENPAGTWVLRITDVSRRIQNEGRIVNWKLILHGTSVQPEHMKQPRVYTNY
NAVQNDRRGVEKMTDFVEDHTTQENLKEKSKVTGGTSGSTDKMGDKIPSEAMLHLLQSAF
SRQMSQNRAPKKTPSEKLNIPYEHFYQALEKLNKPSQLRDSEESLYSDYVDLFYNTKSYK
HRDDRLLQALVDILNEEN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctggatggaatagtcactgatgccattgaagccagttcaatcggttttaatccagaa
catgtggatatttacagtgcaagctggggtccaaatgatgatggtaaaactgtagagggt
cctggcagactagcacagaaggcttttgaatatgggatcaaccagacaagtgctgatctt
catgatgaatgtacagagactcacactggaacctctgcatctgctccattggcagcgggg
atttttgctctagcccttgaagcaaaccctaatctaacatggagggatatgcaacatttg
gtagtctggacatcagaatatgacccactggctggtaatccaggatggaagaaaaatgga
gcagggttgatggtgaatagccgatttggatttggattacttaatgccaaggcactggtg
gatttagctgatcctaaagtgtggaaaagtgtgcctgaaaagaaagagggtatagtcaag
gacaacagttttgaaccaaggttattaagagcaaatggtgaagtaaccatcgaaattccc
acaaaagcttgtgaagggcaagagaattctgttgcatctttggaacatgtgcagtttgag
gcaacgattgaatattcccgcagaggtgatctgcacgtcactctcacttccccatcaggc
accagcactgttctactggctgaaagggagagagataagtctcccaatggctttaaaaat
tgggacttcatgtctgttcacacatggggagagaacccagcaggtacttgggttttaaga
attactgatgtgtccaggagaatccaaaatgaagggaggattgtgaactggaaactgatt
ttgcatggcacttctgtccaacctgaacatatgaaacagcctcgtgtatacacaaactac
aatgctgtgcaaaatgacagaaggggagtggagaagatgacagactttgtagaggaccac
accacgcaggagaacctaaaggaaaaatccaaagtcacaggaggtaccagcggtagcact
gataaaatgggagacaaaatcccatcggaggcgatgcttcacctattgcaaagtgctttc
agcaggcagatgtcccagaatcgagcaccaaagaagactccaagtgaaaagttaaatatt
ccatatgaacatttctatcaagcccttgaaaaattaaacaagccctcccagttaagagac
tcagaggaaagtctatacagtgactacgttgaccttttttacaacaccaaatcatacaag
catagagatgatagactgctgcaggccttggttgatattttgaatgaagaaaactaa

DBGET integrated database retrieval system