KEGG   Alligator sinensis (Chinese alligator): 102377696Help
Entry
102377696         CDS       T02922                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102377696 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 487 aa AA seqDB search
MLKANLQIVGASTKSWEELAADALAEILSVKDISGRKLFYVHYIDSSFPPPTPNPLHDVR
KSLDLSLQPASAPASGKSLPIPVQITLRFNVPREREAVPEEASQPLASSSCGQPAHRNTK
RKVEVVSPATPVPVTTETTQASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGI
PSAPRMTGSLVSDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTALPVLYLCEFC
LKYGKSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDH
KTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLI
EFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMNLKSENGERPQITINEISE
ITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRILRIDSKCLHFTPKD
WSKRGKW
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggcaaacctccagatagtgggcgccagcaccaagagctgggaggagctggct
gctgatgccctggctgagatcctcagcgtgaaggacatcagcgggcggaagcttttctac
gtgcactacattgactcttccttccccccacccacccccaaccccctccacgacgtgagg
aagagcctggatctgtctctacagccggcctcggccccggccagcggcaaatcgctgccc
attccggtgcagataaccctccgctttaacgtgccccgggagcgggaggccgtcccagag
gaggccagccagccgctcgcatccagctcctgcggccagccggcccaccgcaacacgaag
cggaaggtggaggtggtctccccagccacccctgtccctgtgaccacagagaccacacaa
gcctccgtgttcccccaaaacggctcggccaggagagctgtggctgcccagcccggccgg
aagcggaagtctaactgcctaggcacggatgaggactcccaggacagctcggacgggatc
ccctcagccccgcgcatgacgggcagcctggtgtcggaccggagccacgacgacatcatc
acccgcatgaagaacattgagtgcatcgagctgggccggcaccgcctcaagccctggtac
ttctcgccctacccccaggagctgacagctctgcccgtgctctacctctgcgagttctgc
ctcaagtatggcaagagcctcaagtgccttcagaggcacctgaccaagtgtgacctacgg
cacccacccggcaacgagatctaccgcaagggaaccatctccttctttgagatagacggg
cggaaaaacaagagctactcccagaacctgtgcctgctggcaaagtgcttcctggaccac
aagaccctctactacgacaccgaccccttcctcttctacgtcatgactgagtacgactgc
aagggcttccacattgtcggctacttctccaaggagaaggagtccacggaggactacaac
gtggcctgcatcctcacgctgcccccctaccagcgccgtggctatgggaagcttctcatt
gagttcagttatgagctgtccaaggtggaagggaaaacaggcacccccgaaaagccactg
tcggacttggggcttctctcctaccgcagctactggtcccagaccatcctggagatcctc
atgaacctgaagtccgaaaatggggagagaccccagatcaccatcaatgagatcagtgag
atcaccagcatcaagaaggaggacgtcatctccaccctgcagtacctgaacctcatcaac
tactacaagggccagtacatcctgacgctctcagaggacatcgtggatgggcacgagcgt
gccatgctcaagcgcatcctgcgcatcgactccaagtgcttgcacttcacccccaaggac
tggagcaagcggggcaagtggtga

DBGET integrated database retrieval system