KEGG   Alligator sinensis (Chinese alligator): 102377750Help
Entry
102377750         CDS       T02922                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102377750 (DBH)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102377750 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 619 aa AA seqDB search
MQTTGSKRSSCPRFRLREVASMYFTMLALFLVILVAALQGTAPQENYFPYKVPLDPRGLV
ELAWNVSYPEQVVHFQVFIKELKFGLLFGMSDRGDFENADLAALWSDGHSSYFGDAWSDQ
KGHLHMDSQQDYQLLSVRRTPEGLYLVFKRAFSTCDPKDYLIEDGTVHLIYGILEKPVPS
LQAINISAIYKGLQRVQLLKPNITTPELPRDMKTMEIRAPDVVIPSQETTYWCYMVELTD
DFPRHHIVMYEPVITAGNEALVHHMEVFQCAAEFDSFPHYNGPCDSKMKPERLNYCRHVL
AAWAMGAQAFYYPEEAGLAFGGPGSSKYLRLEIHYHNPLVFQGHHDSSGIRLYYTATLRR
YDAGIMELGLVYTPVMAIPPGETEFFLTGYCTDKCTQVALPPAGIHIFASQLHTHLTGRK
VVTVLSREGSEREIVNADNHYSPHFQEIRMLKKVVSVFPGDVLITSCAYNTEDRDQATVG
GFGIMEEMCVNYVHYYPQTQLELCKSAIDPGYLHRYFNLVNRFNDEEICMCPQTSVTQQF
ASVPWNVFNRDVLKSLYGFAPISMHCNKSSAVRFPGEWEKQPLPQIAKMLPAPTPHCPPP
PAPPPPPAVLINLGKTKAD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccactgggagcaagcgctcctcctgccctcgtttcaggctccgggaagtggcg
tccatgtacttcaccatgctcgcgctgttcctagtcatcctggtggcagctcttcaaggc
acagctccccaggagaactacttcccttacaaggtgcccctcgacccccgggggctcgtg
gagctggcatggaacgtcagctacccggagcaggtggtgcatttccaggtcttcatcaag
gagctgaagttcgggctgctcttcgggatgtcagaccggggcgacttcgaaaacgcagac
ctggccgcgctctggagcgacgggcacagctcctactttggggatgcgtggagtgatcag
aaagggcacttacatatggactcccaacaggactaccagctcctcagcgtgcgccgaacc
ccagagggcctctacctggtcttcaaaagagccttcagcacctgtgatccaaaggactac
cttatagaggatggcaccgtgcaccttatctatgggatccttgagaaaccggtcccttct
ctccaagcaatcaacatctctgccatctacaaggggctgcagagggtacagctgttgaag
cctaacatcactacccctgaactgcccagagacatgaagaccatggaaataagagcccct
gatgtagtcattcccagccaggagacgacatactggtgctatatggtggagcttacagac
gacttcccaagacatcacattgtcatgtacgagccagtgatcacagcaggcaacgaagcg
ctggtccatcacatggaagtcttccagtgtgcggctgagtttgacagcttcccacattac
aacggaccctgtgactccaagatgaagccggagcgactgaactactgccgacacgtgctg
gcagcgtgggccatgggagctcaggccttctactaccctgaagaggcaggtctcgccttc
ggggggccgggatcctccaagtatttacgccttgagatccactaccacaaccccctggtc
ttccaaggtcaccacgactcctcagggatccgcctttattacacagccacactgagacgc
tacgatgccggcattatggagcttggcttggtctacacgccggtgatggctatacctcct
ggggaaaccgagttcttcctgacaggctactgtacggataaatgcacccaagtggctctg
cctcctgctgggatccacatcttcgcctcccagcttcacactcacctgacgggaaggaag
gtggtgaccgtgttgtcccgggaaggaagtgaacgggagatagtgaacgcagacaatcac
tacagccctcacttccaggagatccgcatgttaaagaaggtggtttctgtctttccgggg
gatgtgcttataacatcctgcgcgtacaacacagaggacagggaccaagccactgtgggt
gggtttggcatcatggaagagatgtgcgtcaactatgtgcactattaccctcagacgcag
ctagagctgtgcaaaagtgccattgatcccggctacctgcacagatactttaatcttgtg
aacaggttcaatgacgaggagatctgcatgtgcccacagacctcggtcacgcagcagttt
gcttctgtcccatggaacgtgttcaacagagatgtcctgaaatccctctatggctttgct
ccgatctccatgcactgcaataaatcctccgccgtccgcttcccgggcgaatgggagaag
cagcctcttccacagatcgccaagatgctgccagcacccaccccacattgcccccctcca
ccagcacctccgcctccacccgccgtgcttatcaacctgggcaagaccaaggcagactga

DBGET integrated database retrieval system