KEGG   Alligator sinensis (Chinese alligator): 102379264Help
Entry
102379264         CDS       T02922                                 

Definition
polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102379264
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102379264
    1.3.1.94  polyprenol reductase
     102379264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 215 aa AA seqDB search
MHLLPFPGNTLTAGQRFAFIRGKSYEYLSAFLVLLLFWLHSLRRLTECLCISVFSNGVIH
IVHYCFGYAYYIGIGLTVLCQVPVNVRNGKSLWMQIGWYHTLGIIVYIWASVHHNRCHVI
LANLRKNKSGNVVSLNHSIPFGDWFERVSCPHYFAELLIYVSLAITFGFYNLTWWLVVMY
VLFNQALAAILCHEFYLTTFSSYPKHRKAFIPFLF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttctccctttccctggaaatacactcactgcagggcaaagatttgcttttatc
agaggaaaaagttatgaatacctgtctgccttcttggttctcctcctgttttggctgcac
agtcttcgaagactcacagagtgcctctgcatcagtgtgttctccaatggcgtcattcat
attgtgcactactgctttggatatgcttactatattggcattggattaactgtgctatgt
caagtaccagttaatgtcaggaatgggaaaagcctttggatgcaaatcggttggtatcac
accctgggaattattgtgtacatttgggcttctgttcatcacaatagatgtcatgtgatt
ctagctaatcttagaaaaaataaatcaggaaacgttgtaagtttgaatcacagtattcct
tttggagactggtttgagagggtctcctgcccacactattttgcagaactcctaatatat
gtctccctagccatcacatttggattctacaacttgacttggtggcttgtagtgatgtat
gtactctttaatcaggcattggctgccattttgtgccacgagttctacctgaccacattc
agctcctatccaaaacatcgaaaagcatttataccattcctcttttaa

DBGET integrated database retrieval system