KEGG   Alligator sinensis (Chinese alligator): 102379511Help
Entry
102379511         CDS       T02922                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:asn00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102379511 (CLOCK)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102379511 (CLOCK)
Transcription factors [BR:asn03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102379511 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 861 aa AA seqDB search
MFFTVSTHKMSSIADRDDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEISAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTPLLEHLPSDLVDQSIFNFVPEGEHSEVYKILSNHLPESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQTTYEYVKFIGNFKCLNNMPNSAHNGYEGTIQRS
HRPSYEDKVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEITADKSQDSGSDNRINTVSLKEA
LERFDRSPTPSASSRSSRKSSHTAVSDHSSTPTKMTMDTSTPPRQNLSGHEKTTQRRSSL
TSQSLSSQSAGQPLAQPMMSQSASLQIQPGMSQPMFQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQLVHGQGLQMFLQQSPPGLNFGSVQLTSGNSSNLQQLTPINMQ
SPVVQTNQIQGGMNTGHISTQHMIQQQPLQNTVTQHNQPNVLSGHNQQTSLSSQSQSTLS
APLYNTMVISQPTTGNVVQIPSSLPQNNNQSGAAVTTFTQDRQIRFSQGQQLVTKLVTAP
VACGAVMVPSTMFMGQVVTAYPTFAAQQQQAQTLSITQQQQQQQQQGQQQQQQQLSTVQQ
PAQTQLAHHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHPQHQSQQQPPQQQQ
QQQLSRLRTDTMTDPSKIQPQ
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgttctttaccgtgagcacccataaaatgagctccattgcagacagagatgatggtagc
atttttgatgggctggtggaagaagatgacaaggataaagcaaaaagagtgtctagaaat
aagtctgaaaagaaacgtagggatcagtttaatgttctcatcaaagaactgggttccatg
ctcccaggcaatgctcgaaagatggataaatccactgtactgcagaaaagtattgacttt
ttacggaagcacaaagaaatctctgcacagtcggatgccagtgaaatccgacaggactgg
aaaccaacattccttagtaatgaagagttcacacaattaatgttggaggctcttgatggt
ttttttttagcaatcatgacagatggaagtataatatatgtgtctgaaagtgtaactccc
ttacttgaacatttaccatctgatcttgtggatcagagtatatttaattttgtcccagag
ggagaacattcagaagtttataaaatactgtctaatcatctgccggaaagcgattcattg
accccagaatatttaaaatcaaaaaatcaactagaattctgttgccatatgctacgagga
acaatagacccaaaggagcaaactacatatgaatatgtaaagtttataggaaatttcaag
tgtttgaacaatatgcctaactcagcacacaatggttatgaaggaactattcagcggtcc
cataggccgtcatatgaagacaaagtttgctttgtagctacagtaaggttagctacacct
cagtttatcaaggaaatgtgtactgttgaagaacccaatgaagagttcacatccagacac
agcttagaatggaagtttctgttcttggatcacagggcacctccaataataggctattta
ccatttgaagttctggggacatcaggctatgattactatcatgtggatgacctagaaaat
ctggcaaaatgtcacgaacacttaatgcaatatgggaaaggaaagtcgtgctattacagg
ttcctgacaaaggggcaacagtggatttggctacaaacccattactatattacttatcat
cagtggaattccagaccagagtttattgtctgtacacacactgtagtaagctatgcagaa
gttcgagcagaaagaaggcgagaacttggtattgaagagtctcttccagagataacagca
gataaaagtcaggactctgggtctgacaatcgtataaatacagtaagtctcaaagaagct
ttggaaagatttgatcgcagccccacaccttctgcttcctccaggagttcaaggaaatct
tctcatactgcagtctcagatcattcatcaacaccaacaaagatgacaatggacactagc
acccctccaagacaaaatttatctggccatgaaaagactacacaaagaagatcatcactt
actagccagtctttaagctctcaatctgctggacaaccattagcacagccaatgatgtct
caatctgcatctttacagatccagccaggcatgtcccagcctatgtttcagttttcagct
cagttaggagctatgcagcacctgaaggaccaattggagcaaagaacgcgaatgatagag
gcaaatattcatcgacagcaagaagagttgcggaagattcaagaacaacttcaactggtc
catggtcaaggacttcagatgttcttgcagcaatcacctcctggactaaactttggttct
gtgcaacttacttctggaaactcttctaaccttcagcagctgacgccaataaatatgcaa
agtccagttgttcaaactaatcaaattcaaggaggaatgaatactgggcatattagtact
cagcatatgatacagcaacagcctttgcaaaatactgtaacacagcataatcaaccaaat
gtacttagcggacacaatcaacagacttctctctccagtcaatcacagagcacgctttcg
gcccccttgtataacactatggtgatttcccagccaacaacaggaaatgttgtccagatt
ccatcaagcttaccacagaacaataaccagagtggtgcagccgtaaccactttcacacaa
gatagacagatcaggttttctcaaggtcagcaacttgtaacaaaattagtcactgcccct
gtagcatgtggagcagtaatggtaccaagcactatgtttatggggcaggtggtgacagcc
taccctacttttgctgcacaacagcaacaggcacagacgttatcaattactcaacagcag
cagcagcaacaacagcaaggtcagcaacagcagcaacagcagctcagtacagttcagcaa
ccagctcagactcagctggcccatcatccccaacagttcttacagacatccaggttactt
catggaaaccaatcagctcagctcattctttctgctgctttcccactacaacagagcact
tttactcagtctcaccacccgcaacatcaatcgcagcagcagccaccgcagcagcagcag
cagcagcaactttcgagacttagaactgacaccatgactgatccttccaaaattcagcca
cagtag

DBGET integrated database retrieval system