KEGG   Alligator sinensis (Chinese alligator): 102380608Help
Entry
102380608         CDS       T02922                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102380608 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1404 aa AA seqDB search
MSGLGENSLDSLTNESRKRKSLPCDTPGPGLNCSGEKRRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKTASSDDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKAAV
NGVAWTNETPRQKSHTFNCRMMVKTCHDLLEDVGSNQDTRQRYETMQCFALSQPRAMMEE
GEDLQSCMICVARRITTVERVFPANPESFITRHDLSGKLINIDTNSLRSSMRPGFEDIIR
RCIQRFLCHNDGQTWSNKRHYQEAYIQGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTN
DRHGFVSTHLLQREQNGYRPNPNPVGQSIRAPTAGSTNSVGAIMNMPPGQSMPIQNRNYG
MGDPSAVGQMSSTRYGGPGNMGPMNSGPGMQSSPFQNNNYGLNMSSPPHGSPGLTSSQQN
LMISPRHRGSPKMGSHQFSPVAGMHSPMGSATNTSNNSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNIAQQSKMGNQDSKSPVLYCEQSQVESSMCQSNSRDLLTDKDNKE
GSLEGSESQRGPSESKGHKKLLQLLTCSSEERGHATLSNSPLDSNCKESSTSVTSPSGVS
SSTSGGVSSSSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTYHESSNTTPC
GEGTIKQEQLSPKKKENNALLRYLLDKDDIKDPLSKDIKPKVESLDNKMGQCSSSSISTS
NQEKEIKVKIEPSEEMSGDLDNLDAILGDLTSSDFYSNANSANGSNLGTKQAIYQGNAPL
GMRSPQSMQATRPPFNRAMSLDSPIPMGSSPPVRSVNAFSMLQKQNMMGGNSRMIESQEN
FGANIGAPNRSMTMNQHPAGDWGLPNSKVNRLEPTSSSSMMRPGADYNTSLPRPTIGSSV
PGLPIRSNSIPGTRPILQQQMIHMRPNEINMGMGGNPYAQPGPSSQPASWPDSMLAIEQG
SRGSQSRQLVRSSLDDLLCPPPNVEGQNDERALLDQLHTLLSNTDVTGLEEIDRALGIPD
LVNQGQTLEPKQDTFQGQESAVMIDQKPPLYGQPYQGQGTAVPGGFSNMQGQQPSFNSMM
NQISHQSNFPLPNVHPRASVMRPRTNTPKQLRMQLQQRLQGQQFMNQTRQALEMKMENPG
ATVAPVMRPVMQPQVGSQQGFLNAQMMAQRNRELLSHHIRQQRMAMIMQQQQQQQQPQAF
SPPPNVTASGSMDSALAGPPMAQVPPQQFPYPPNYGINQQPDPAFSRVSSPPNPMMSSRI
GPSQNPMMQHPQTAPMYQSPEMKGWPSGTMARSSSFSQQQFSHQGTPATYNMMHMNGTGG
HIGQMNLNTMPMSGMPMGPDQKYC
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaattctttggacagcttgaccaatgagtcaaggaaacggaag
tcgttgccctgtgatacgccaggaccaggtctgaactgcagtggtgagaagcgtcgacgt
gagcaggaaagtaaatacattgaagaactggctgagctgatatctgctaatctgagtgac
attgacaatttcaatgtcaaaccagacaaatgtgcaattttaaaggaaactgtaagacag
attcggcagataaaggaacaaggaaaaacagcgtccagtgatgatgatgtacagaaagct
gacgtatcttctacaggtcaaggcgttattgataaggattcattgggacctcttttactt
caggcattggatggcttcctgtttgttgtaaatagagatgggaacattgtatttgtatca
gaaaatgttacacaatatctacagtataaacaagaagatttggtgaatacaagtgtctat
agcatcttgcatgaagaggaccggaaggacttccttaaaaacttacctaaagctgcagtt
aatggagttgcttggaccaatgaaacgcctaggcagaagagccacacgtttaattgccgc
atgatggtgaaaacttgtcatgatcttttggaagatgtaggtagcaatcaagatacccgt
caaagatatgaaactatgcagtgctttgctttatctcagccaagagctatgatggaagaa
ggagaggatttgcagtcctgtatgatttgtgtggcacgtcgtatcactacagtggaaagg
gtatttccagcaaacccagaaagcttcattactagacatgacctttcaggaaaactaatc
aacatagatacaaattcattgcgatcatccatgagacctggctttgaagatataattcgt
cgctgtattcagaggtttttatgtcataatgatggacagacctggtcaaataaacgtcat
tatcaggaagcttacatccaaggccatgctgaaactcccctgtatcggttttccttagca
gatggtactatagtgacagcacaaacaaagagtaaattgttccgaaatccagtaactaat
gaccgccatggatttgtctctactcatttgcttcaaagagaacaaaacggatatcgacca
aatcctaatccagtgggacaaagtatcagagcacctacagctggaagcacaaattcagtt
ggtgctattatgaatatgccaccaggtcaaagcatgccaatacagaacaggaactatggc
atgggagatcccagtgcagtaggtcagatgagcagcactagatatggaggtcctggtaat
atgggaccgatgaactctggaccaggaatgcagtcatctccttttcagaacaacaattat
gggttaaatatgagtagcccaccccatggtagtcctggcttgacttccagccaacagaat
ttgatgatttcccctaggcatcgagggagtccaaaaatgggttcacatcagttttctcca
gttgcaggtatgcattctccgatgggatctgctaccaacactagcaataacagcttctct
agcagttcccttagtgctcttcaagccatcagcgagggtgttggcacttcccttttatca
acactttcttcaccaggaccaaaactggataattccccaaatatgaatatagctcaacaa
agtaaaatgggcaaccaagactcaaaaagccctgtcttatattgtgaacagagtcaagtg
gagagttccatgtgtcagtcaaacagcagggacctccttactgataaagacaataaagaa
ggaagtctggaagggtctgagagtcagaggggaccatctgaaagcaaaggtcacaaaaag
ctccttcagttactcacgtgctcctcagaggagaggggccatgctacattatcaaattca
ccactggactctaattgtaaagaatcttccaccagtgttacaagtccctcaggagtctct
tcttctacatctggaggcgtatcttcctcatcaaatatgcatgggtccttgcttcaagag
aagcacaggattttgcataagttgttgcagaatggtaattctccagcagaggtagccaag
atcacagctgaagctactggtaaagacacataccatgagtctagcaatacaactccttgt
ggagaaggaactatcaaacaggagcaactgagtcctaagaagaaggaaaacaatgctcta
ctcagatacctgttagacaaggatgatataaaggatcccctttcaaaagatattaaacct
aaagtggaaagtctggacaacaaaatgggacaatgcagtagctcttctatttctacttca
aatcaagaaaaggagattaaagtaaaaattgagccaagtgaagagatgagtggtgacttg
gataatttggatgcaattctgggtgatctgactagttctgatttttacagtaatgctaat
tctgcaaatgggagtaatcttggaacaaaacaagcaatatatcaaggaaatgctcccctg
ggtatgagaagtccccagtccatgcaggctacccgtcctcctttcaacagagccatgtca
ttagacagccctatacctatgggttcaagccctccagtgaggagtgtcaatgcattctcc
atgttacaaaagcaaaacatgatgggtgggaattcaagaatgattgaaagccaggaaaat
tttggagcaaatataggtgcacccaacagaagtatgactatgaatcaacacccagcaggt
gactggggcttaccaaactcaaaggttaacagattggaacctacaagctccagttcaatg
atgagaccaggagcagattataatacttcccttcccagaccaacaattggtagctctgtg
cctggtttgcccatccgatctaatagcatacctggtacaagaccaattctacaacagcag
atgattcatatgaggcccaatgagattaatatgggtatgggagggaatccttatgcacaa
ccaggaccatctagccagccagcatcgtggcccgatagcatgttagccatagagcaagga
tctcgaggttcacaaagcagacaattggtgagaagttctttggatgatctcttatgtccg
cctcctaatgtggaaggccagaatgatgaaagggctcttttagatcagctgcacacactg
ctgagtaacacagatgtcacaggactggaggaaatagacagagcattaggaattcctgat
cttgtaaatcaagggcaaactttggaacccaagcaagatacatttcaaggtcaggaatct
gcagttatgattgatcagaagcctccattatatggccagccttatcagggacaggggaca
gcagtgccaggaggctttagtaatatgcaaggacagcagccatcttttaattcaatgatg
aatcagataagccatcagagcaattttccactcccaaacgtgcatcctagagcaagtgtg
atgagaccccgaaccaatacaccaaagcaactccgaatgcagctccagcagaggcttcag
gggcagcagtttatgaatcagactcgtcaagcacttgagatgaaaatggagaatccaggt
gctactgttgccccagtgatgaggccagttatgcagccacaagtgggatcacagcaaggt
tttcttaatgctcagatgatggctcagcgcaacagggagctattaagtcatcatatcaga
cagcagaggatggcaatgataatgcaacagcagcagcaacagcaacaacctcaggccttc
agtcccccaccaaatgtgactgcctcaggaagcatggatagtgctttggcaggtcccccg
atggctcaagttcctccacagcaattcccatatccacctaattacggaataaaccaacaa
ccagatcctgcatttagtagggtttcaagccctcccaacccaatgatgtcatcaagaatt
ggaccctctcaaaatcccatgatgcagcaccctcaaacagcaccaatgtaccaatcccct
gaaatgaagggctggccatcaggaaccatggccaggagcagttctttttcacagcagcag
tttagccatcaggggacccctgcaacttacaatatgatgcacatgaatggtaccggtggc
catattggacaaatgaaccttaataccatgcctatgtcagggatgcctatgggtccagac
cagaaatactgttga

DBGET integrated database retrieval system