KEGG   Alligator sinensis (Chinese alligator): 102381149Help
Entry
102381149         CDS       T02922                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102381149 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102381149 (PIK3CG)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102381149 (PIK3CG)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102381149 (PIK3CG)
Membrane trafficking [BR:asn04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102381149 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 1117 aa AA seqDB search
MAHLLLLISSGMELGNHEQPVVMREENKRRRRRMKPYCTANNLSSMELIPIEFVLPTSPK
HTKTPEIVTLEIAGNCTVEQMKAQIWMHAIEMSQTSDFCHKYTPDQFILQYQKKGQWYEI
YDKHQVIQTLDCILYWKVLQKKVGRIYVVQKQKPSVEVQEFQKQLNDLIGYDVTDVSNVH
DDELEFTRRRLVTPRMIEVACRDPKLYSMHPWITSKPLPEYLFKKITNNNIFINIHRGTT
SQKIKISIDDTPDMILQSFFTKMAKKKSLMDIPEDHSELDFVLRVCGRDEYITGETPVKD
FHCIRQCLKNGEEIHLVLDTPPDPNEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERV
FTISLWDCNRKFRVKIIGIDIPVLPRNTDITVFVEANIQHGQQLLSQRRTASKPFTEEVL
WNTWLEFDIKIKDLPKGALLNLQVYCGKTQSLSTKANLQSHDSPSSDSKCKTQLLYYVNI
LLIDHRFLLRSGEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAVSIVLDKYCHP
IALPKHRITSDTQGDGARTEMPNQLRKQLEEIIATDPLNPLTAEDKELLWHFRYESIKHP
KAYPKLLSSVKWGQQDLVAKTYQLLAKKEAWDQSTLDVGLTMQLLDCNFSDENVRAMAVQ
KLECLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQS
MHYQQRFAVILEAYLKGCGKAMLCDFMKQVQVIELLHTVTMEIKSVSAEKYDVTSQVITQ
LKQKLEKLQNNKLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFKCADPTALSNE
TIGIIFKHGDDLRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDAT
TIAKIQQSTVGNTGAFKDEILNQWLKERCVIEEKFQAAVERFVYSCAGYCVATFVLGIGD
RHNDNIMITESGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSQHF
HKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKK
YFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggcccatctcctgcttctgatttcttctggcatggagttggggaatcatgaacagcct
gttgttatgagagaggaaaacaaacggaggaggagaagaatgaagccttattgtacagca
aataatttatcttcaatggaactgatacccattgagtttgttctacccacaagccctaaa
catactaaaaccccagaaatagtgacacttgaaattgctggcaactgtactgttgagcaa
atgaaagcacagatttggatgcatgcaatagagatgagccaaacctcagacttctgccat
aaatacaccccagatcagtttattcttcaatatcaaaagaaaggacagtggtatgaaatt
tatgacaaacatcaggtaattcagacattggactgtatactatattggaaagtgttacag
aaaaaggtaggcagaatctatgttgttcagaagcagaaaccatcagtggaagttcaagaa
tttcagaagcagctgaatgacttaataggatatgatgtcactgatgtaagtaatgtgcat
gatgatgaactagaatttacacgccgcaggctggtcactccacgaatgattgaagtagcc
tgcagagatccaaaattgtattcaatgcacccatggattacctccaagccccttcctgag
tatttgtttaaaaagattactaataataatatttttataaacatacatagaggaacaact
agccagaaaattaaaatctcaatagatgatactccagatatgatccttcagagctttttc
acaaaaatggcaaaaaagaaatctttgatggacattcctgaagatcacagtgaactggac
tttgttctcagggtttgtggcagagatgaatatattacaggggaaacgccagtcaaagat
tttcactgtataagacagtgccttaagaatggggaagaaattcaccttgtgctagacact
cctcctgaccctaatgaggatgaggttcagaaagaagagtggccattggtggatgactgc
acaggagttacaggatatcatgaacagttgacaatcgatggaaaagatcatgagagagtg
ttcactatctctttgtgggactgtaatagaaaatttagagtcaagataattggcattgat
attccagtgctacccagaaatactgacatcactgtatttgttgaggctaatattcaacat
gggcaacaactcctttcccaacgaaggactgcatctaagcctttcaccgaggaggttctg
tggaatacctggctagagtttgatattaaaattaaagacttgcctaaaggagcactactg
aatctgcaggtgtattgtggcaaaacacagtcattatccacaaaggccaaccttcagtca
catgattctcccagttctgactctaaatgcaaaacccagcttctctactatgtaaatatt
ttgttgatagatcaccgtttcttgctacgaagtggggagtatgtgcttcatatgtggaaa
attccaggtaagggggaagagcagggaagcatcaatgctgacaaacttacatcagcaact
aatcctgataaagaaaactcaatggcagtctctattgttttagacaaatactgccaccca
atagctttgcccaaacacaggataacatccgatactcagggagatggggcaagaactgaa
atgcccaaccaacttcgcaaacagctcgaagagatcatagccactgacccacttaacccg
cttactgctgaggacaaggaattattgtggcatttcagatacgaaagcataaagcacccc
aaggcatatcctaagctgcttagctcagtgaagtggggacagcaagatttagtggccaaa
acataccagttattagctaaaaaagaagcatgggatcaaagcactttggatgttggactg
acaatgcagcttttggactgcaatttttcggatgaaaatgtaagagcaatggcagttcaa
aaactcgagtgtttagaagatgatgatgttctccattaccttttacaattagtacaggct
gtgaaatttgagccctatcatgacagtgcactggccagatttctactaaaacgaggtttg
agaaacaaaagaattggtcacttcttattttggtttctaagaagtgagattgcccagtcc
atgcactaccagcaaaggtttgctgtaatcctggaagcttacctgaagggctgtggaaaa
gccatgctatgtgatttcatgaaacaggttcaagtaatcgaattgctgcatacagtcaca
atggagataaaatctgtttctgctgaaaagtatgatgtcacttctcaagttatcacacag
cttaaacaaaagctggaaaaactgcagaacaacaaacttccagaaagcttcagagtacca
tatgaccctggactgagagcaggggcactggtgattgaaaaatgcaaagtaatggcatcc
aagaaaaagcccctctggcttgagtttaaatgtgcagatcccacagctttgtcaaatgaa
actataggcattatcttcaaacatggagatgacctccgtcaggacatgcttattttgcag
attctacgaatcatggagtccatttgggaagcagaatccttggacctgtgtttgctacca
tatggatgcatttctactggaaacaaaataggaatgattgaaattgtgaaggatgctaca
acaattgctaaaattcaacaaagtacagttggcaacacaggtgcatttaaggatgaaata
ttaaaccagtggcttaaagaaagatgtgttattgaagaaaagtttcaggcagcagtggaa
agatttgtttattcttgtgctggttactgtgtggcaacctttgtacttggaataggagac
agacacaacgacaacattatgattacagaatcaggcaatctttttcacattgactttggc
catattcttgggaattacaaaagtttccttggaattaataaggaaagagtcccttttgtg
ttgacaccagattttctgtttgtcatgggcacttctggaaagaaaacaagtcagcatttc
cataaatttcaggatgtttgtgtgaaggcttatctagctcttcgacatcacaccaacctg
ctgatcattctgttctccatgatgctaatgactggaatgccccagttaaccagcaaggaa
gatattgaatatatcagagatgcattgacagtaggtaaaagtgaggaagatgctaaaaag
tatttccttgatcagattgaggtttgcagagataaaggctggactgtacaatttaactgg
tttctgcatcttgtgcttggaatcaaacaaggagtagagaagcattctgcctaa

DBGET integrated database retrieval system