KEGG   Alligator sinensis (Chinese alligator): 102381176Help
Entry
102381176         CDS       T02922                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102381176 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 681 aa AA seqDB search
MGDSGMDPTVSPPESTAQEASFLSMTDMFLISLIIGLFSYWFFFRKKKEEVPEFTKIQQT
TSSSSSSGGDSNFVDKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGMRGLGADPEE
YDLSDLSRLSEIDNSLAVFCMATYGEGDPTDNAQDFYDWLQEADVDLSGVKYAVFGLGNK
TYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEAT
GDESSIRQYELVVHTDMNMNKVYTGEMGRLKSYESQKPPFDAKNPFLAPVTKNRKLNQGG
ERHLMHLELDISGSKVRYESGDHVAVYPANDSTLVNQIGEILGADLDTIMSLNNLDEESN
KKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYATDANEQDRLRKMASSAAEGKEFY
LSWVVDSRRNILAILQDMPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVTV
EYETKTGRLNKGVATTWLKNKVPNENGNKSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGI
APFVGFIQERAWLKQQGKEVGDTVLYYGCRHEKEDYLYQEELTQFHKEGALTQLNVAFSR
DQAQKVYVQHLLKQNKEGVWKLIHEGNAHIYVCGDARNMARDVQNTFYEIVAEYGNMSQP
QAVDYVKKLMTKGRYSMDVWS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgggggattccggcatggatccaactgtgtctccgcctgagagcactgcacaggaggct
tctttcttgagcatgactgacatgttcctcatctctcttatcattggcctcttttcttac
tggtttttcttccgcaagaagaaggaggaagtccctgaattcaccaaaatccagcaaaca
acctcttcctcctcttcttcaggaggagacagcaactttgtggacaagatgaaaaagacg
gggcgaaacatagtggtattctatggctcccagactgggacagcagaggagtttgccaac
cgtctttccaaagatgcccatcgttatggtatgaggggcctcggagctgatccagaggag
tatgacttgtctgatctgagccgcctctctgagattgacaattccttggctgtgttctgc
atggccacatatggagagggtgaccccacggacaatgcccaagacttctatgattggctg
caggaggctgatgtggacttgtctggtgtcaagtatgcagtgtttggacttggaaacaag
acttacgagcacttcaacgcaatggggaagtacgtggacaagagactggagcagctcgga
gcccagcgaatctttgagcttgggttgggtgatgatgatgggaacctggaagaagatttc
attacttggcgtgagcagttttggccagcagtttgtgagcactttggcgtggaagctaca
ggagatgagtccagcattcgtcagtatgagttggttgtccacacagatatgaacatgaac
aaagtctacactggggagatgggccggctcaagagctacgagagccagaaacccccgttt
gatgcgaagaaccctttcctggcacctgtgaccaagaacagaaaactgaaccagggtgga
gagagacacctcatgcatttggagctggatatctcaggttccaaagtcaggtatgaatct
ggggaccatgttgccgtctacccagccaatgactcaacgttagtgaaccagattggtgag
attctgggagcagacctggatacaatcatgtccttaaacaatctggatgaggaatccaat
aagaagcatccattcccttgccccacctcttaccgcacagccctgacctactacttagat
atcactaacccgccacgtaccaatgtcctatatgagctggctcagtatgccacagatgcc
aatgagcaggatcgcctccgcaaaatggcttcctctgctgctgagggaaaggagttttac
cttagctgggtcgttgattccaggaggaacatcttagccatcctacaggacatgccttct
ctgcgaccacccattgaccacctctgtgagctgctgccacgcctgcaggcccgttattac
tccattgcctcttcctccaaggttcaccctaactccatccacatctgtgctgtgaccgta
gagtatgagaccaagactggccgtctgaacaagggagtggccaccacctggctgaagaac
aaggtgcctaatgaaaatgggaacaagtccttagtgcccatgtatgtcaggaagtcacag
ttccggttgcctttcaaacccagcacacctgtcatcatgattgggcctgggactgggatt
gcccctttcgttggcttcattcaagaacgtgcctggctgaagcagcaaggcaaggaggtt
ggtgacacagtgctgtactatggctgtcgccatgaaaaagaggattacctctaccaagag
gagctcacccagttccacaaggagggagccctcacccagcttaacgtcgccttctccagg
gaccaggctcaaaaggtttatgttcagcacttattgaaacaaaacaaagaaggtgtctgg
aagctgatccatgagggaaatgctcatatctacgtgtgtggtgacgctcgcaacatggct
cgagatgtgcaaaacacgttctacgagatcgtggctgagtatgggaacatgagccagcct
caagccgtggactatgtaaagaagctgatgaccaagggccggtactccatggacgtctgg
agctag

DBGET integrated database retrieval system