KEGG   Alligator sinensis (Chinese alligator): 102381202Help
Entry
102381202         CDS       T02922                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102381202
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102381202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MGAQLSTLGGIVIYPVWLVYTFIMRLFRKPHPAITLQDPEVKYALRLIDKEEVSHDTRRF
RFALPTREHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKIYFRGVHPK
FPDGGKMSQYLDSLKIGDTIDFRGPSGLLVYQGKGKFAIRPDKKSEPVTRTVKYVGMIAG
GTGITPMLQLIRAIMKDKDDPTVCNLLFANQTEKDILLRPELEEVRVEYPDRFNLWYTLD
RAPENWEYSQGYVNQDMIRDHMPPPQDDVLILMCGPPPMIQYACTPNLDKLGYIKDMVFS
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcagcttagcacgctgggaggtattgtgatttatccagtatggctagtttac
accttcatcatgcggctcttcaggaaaccccatccagcaattaccttgcaagaccctgaa
gtgaaatatgcattaagactgattgacaaggaggaagttagccatgatacaaggagattt
cgttttgcccttccaactcgagagcacattctgggtctccctataggacagcacatctac
ttgtctactcggattgatgggaatctggtcatcagaccctacacacctgtgtccagtgat
gatgacaaaggctttgtggatcttgttgtgaagatttactttagaggggtccatccaaag
ttccctgatggaggaaagatgtctcagtacttagacagcctcaaaataggagataccatt
gactttaggggacccagtggcttacttgtctaccaaggaaaaggcaagtttgctattcgt
cctgacaagaaatctgaacctgttacaagaacagtgaaatatgttggaatgattgcaggt
ggaactgggataacacccatgctacaacttatacgagccatcatgaaggataaagatgat
cccactgtttgcaatcttctgtttgctaatcagactgaaaaggatatcctgttgcgccca
gaactagaggaagtccgggttgaatatccggaccgttttaacctttggtacacattggat
agagcaccagagaattgggagtatagccaggggtatgtgaatcaagatatgatcagagac
cacatgcctccacctcaagacgatgttctgatcctaatgtgtggtcctcctccaatgatc
cagtatgcttgcacccccaacttggacaagctggggtacatcaaggacatggtgttctcc
tactaa

DBGET integrated database retrieval system