KEGG   Alligator sinensis (Chinese alligator): 102381650Help
Entry
102381650         CDS       T02922                                 

Definition
(RefSeq) lysozyme C-like
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102381650
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102381650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MKALIFLELFLLLLTAHGKIYERCELAAAMKRLGLANIRGYTLGDWVCTAKYESNFNTNA
INYNSGDGSTDYGILQINSRWWCNDGKTPRAKNACRIQCSEFLKPDITAAINCAKRIVRD
PQGMNAWMAWTRHCKGKYVSQYLKGCKL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctgatttttctggagctttttctcctgctgctgactgctcatgggaagatc
tatgaaaggtgcgagctggctgcagccatgaaaaggcttgggttggctaacattcgagga
tacactttaggagactgggtgtgtacagcaaaatatgagagcaactttaacacaaatgcc
ataaactataactccggtgatggaagcacggattatgggattttgcaaatcaacagccgc
tggtggtgcaatgatggcaagactccaagagccaagaatgcatgcagaatccagtgctca
gagttcctgaagccagatattacggcagctattaattgtgcaaagaggattgtcagagat
ccacagggcatgaatgcatggatggcatggacaaggcactgcaaaggaaaatatgtctcc
cagtacctcaagggctgcaaactgtaa

DBGET integrated database retrieval system