KEGG   Alligator sinensis (Chinese alligator): 102382591Help
Entry
102382591         CDS       T02922                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:asn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:asn01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:asn03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 358 aa AA seqDB search
MPALVLQEKLSKDFPLATSTITAGVTRNGEAVMEKNLSNPEKMSVARSMTDDIFDETYRE
KEGPKPTKIYVWRNIFLMSVLHVGGLYGISLIPSAKLMTLGWGIICFLVSALGVTAGAHR
LWSHRSYKATWPLRIFLAVANSMAFQNDIYEWARDHRVHHKFSETDADPHNASRGFFFSH
IGWLLVRKHPDVIEKGKTLDLSDLRADKVVMFQRRYYKPSVVIMCFLVPTIVPWYFWGES
LVISYFIPAILRYAVVLNASWLVNSAAHMFGNRPYDQNINPRENHFVVLGALGEGFHNYH
HTFPFDYSTSEFGWHYNFTTAFIDLMYFLGLASDCKKVSKEVIRARKIRTGDGSHKTG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcgtgctgcaggagaagctctccaaggatttccctttagccaccagcacc
attactgcaggggtgacaaggaatggggaagcagtcatggagaagaacttgtccaaccct
gagaaaatgtcagttgcccgcagcatgacagatgatatctttgatgagacctaccgtgaa
aaggagggccccaagcctaccaaaatatatgtctggagaaatatcttcctcatgtctgtg
ctgcatgtaggaggcttatatgggatctccctgataccttcagcaaaactgatgactctg
ggatggggtatcatatgttttctggtgagtgccttgggggtaactgctggagcacatcgc
ctctggagtcatcggtcctacaaagcaacttggcccctcagaatcttcctggctgttgcc
aactccatggccttccagaatgacatctacgagtgggcccgagatcaccgtgttcaccac
aagttttctgagacagacgcagaccctcacaatgccagccgcggcttcttcttctcccac
atcggctggctgctagtgcgcaaacatcctgatgtcattgaaaagggcaagacactagac
ctgtctgatctgagggctgacaaagtggttatgttccagaggaggtactacaagccttca
gtggtgatcatgtgcttcttggtgcccaccatagtgccctggtatttctggggggaatcc
ttggtcatcagctacttcatccctgctatcctgcgctacgctgtagtgctcaatgccagc
tggttagtcaacagtgcagcccatatgtttggcaaccggccctatgatcaaaacatcaac
ccacgggagaatcactttgtcgtcttgggagccttaggagaaggattccacaattaccac
cacaccttcccctttgactattccacgagtgaattcggctggcactacaactttacaaca
gcttttatcgatcttatgtacttcctgggtctggccagcgactgcaagaaggtgtccaag
gaagtcatccgggctcggaagattcggactggagatgggagccacaagactggctga

DBGET integrated database retrieval system