KEGG   Alligator sinensis (Chinese alligator): 102384330Help
Entry
102384330         CDS       T02922                                 

Gene name
CKB
Definition
creatine kinase, brain
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102384330 (CKB)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102384330 (CKB)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102384330 (CKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MPFSNSHNLLKMKYPAEDEFPDLSVHNNHMAKVLTPELYSKLRGKQTPSGFTLDDIIQTG
VDNPGHPFIMTVGCVAGDEESYDVFKELFDPVIEDRHGGYKPSDEHKTDLNSDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALGSLDGDLKGKYYALKNMT
DAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGMWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFTRFCSGLTQIETLFKTKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFGDILKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
VEMEKQLENGQSIDDLIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctcgaacagccacaacctgctgaagatgaagtacccggccgaggacgagttc
ccggacctgagcgttcacaacaaccacatggccaaggtgctgaccccggagctgtactcc
aagctgaggggcaagcagacacccagcggcttcacgctggacgacatcatccagactggg
gttgacaacccaggccatcccttcatcatgacggtaggatgtgtagctggtgatgaagaa
tcctatgatgtgtttaaggaactctttgatccagttattgaagaccgacatggaggctac
aaaccaagtgatgagcacaagactgacttgaactctgataaccttcagggtggtgatgac
ctggatcctaactatgtgctaagttcccgtgtcagaactggtagaagtatccgtggattt
tgtcttccccctcactgtagcagaggagagagacgggcgatagaaaagctttctgttgaa
gccctgggaagtctggatggtgacctgaaagggaaatactatgctctgaagaatatgact
gatgcagagcagcagcagctgattgatgatcacttcctgtttgataagccagtttctcct
cttctgttggcatctgggatggcacgagactggccggatgccagagggatgtggcacaat
gacaacaagaccttccttgtctggatcaatgaggaagatcaccttagagttatttctatg
cagaaaggaggcaatatgaaagaagtattcacccgcttctgcagtgggctaacgcagatt
gaaacactgtttaaaacaaaaaattatgaattcatgtggaacccccacttgggctacatc
cttacctgcccatccaacctgggaacaggtctccgtgctggtgtccatatcaagctgcca
aaccttggcaagcatgagaagtttggagacattctcaagaggctgaggctgcagaaacga
ggcacaggtggtgttgatactgctgctgttggaggagtgtttgatgtttccaatgctgac
cgtctgggtttctcggaggtagagctggtgcagatggtggttgatggtgtgaagctgctt
gttgaaatggaaaaacaacttgaaaatggtcagtctattgatgacctcataccagctcag
aaataa

DBGET integrated database retrieval system