KEGG   Alligator sinensis (Chinese alligator): 102385725Help
Entry
102385725         CDS       T02922                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102385725
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102385725
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102385725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 627 aa AA seqDB search
SDPSLWLNPKVIAGEPRHTQDTHTTPSIPQTLDRHKTPLISHSLKLKLVIRNRSGEILYR
ISPWAKYVIREEGKVNYDWMHWEPPLPYLSRHPSPEKPKSLRIYESHVGIASPEGKIASY
KNFTYNVLPRIKDLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPDDLKELIDVA
HSMGITILLDVVHSHASKNSEDGLNKFDGTDSCFFHSGPKGTHGLWDSRLFDYSNWEVLR
FLLSNLRSWIEEYSFDGFRFDGITSMLYHNHGIGESFSGDYHEYFGLHVDEDALVYLMLA
NHMIKFLHPRCLTIAEEVSGMPALCCPVTEGGGGFDYRMAMAIPDKWIQIIKELKDEDWD
MGNIVYTLTNRRHEEKYISYAESHDQALVGDKTLAFRLMDAEMYTNMSVLSPLTPVIDRG
IQLHKMIRLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFQLADDHVLR
YRFLNAFDRDMNKLEERFGWLASPPGFVSEKHESNKVIAFERANLIFIFNFHPSKSYVDY
RVGIGKPGYYKIVLDSDAPEYGGHQRLDHGTEYFTEQYPHNYQPNSLLRANSQTSFDGKP
RRCYLNHLQVYIPSRVAIVLQNLDIPN
NT seq 1885 nt NT seq  +upstreamnt  +downstreamnt
cagtgatcctagtctgtggctgaatcccaaagtgattgctggggagcctcgtcacaccca
ggatacacacacgactccaagcattccacagacactagaccgtcacaaaacacctttaat
ctctcacagtcttaaactcaagttggtgatccgtaatagaagtggagagatcctttaccg
catttcaccttgggcaaaatatgtaattcgtgaagagggcaaagtgaattatgactggat
gcactgggaaccaccattaccatatcttagtagacatccttcccctgagaaaccgaaaag
cctaagaatctatgagtctcatgtgggaattgcttcccctgaagggaaaatagcttctta
taaaaactttacttacaatgtactacctagaataaaggatctcggatacaattgcattca
gttgatggctattatggagcatgcctactatgccagttttggttaccagataacaagttt
ttttgcagcatcaagtcgttatgggaccccagatgacctgaaggaattgattgatgttgc
ccactcaatgggaattactatactattggatgttgtgcacagccatgcatcaaagaactc
agaggatggtttgaacaaatttgatggcacagactcctgtttttttcattctggacctaa
gggaacgcatggtctttgggacagcagactttttgattattcaaactgggaagttttgag
gttccttctttccaacttgagatcatggatagaagaatatagctttgatggcttccgttt
cgatggtattacatctatgctataccacaatcatggaattggtgaatctttcagtggaga
ttaccacgaatattttggtctacatgtagatgaagatgctctggtttatctaatgttggc
caaccacatgatcaagtttttgcatcccagatgtctaaccatagctgaggaagtttctgg
aatgccagctctttgctgtcccgttacagagggaggaggtggatttgattatcgaatggc
catggcaattccagataaatggatacagataattaaagagttgaaagatgaagactggga
tatgggcaatatagtatatacactgaccaacaggaggcacgaagagaaatatatttcata
tgcagagagtcatgaccaggccctcgttggtgataagacattggcattccggctgatgga
tgcagagatgtatacaaatatgagtgtgctttcccctcttactccagttattgatcgtgg
aatacagcttcataaaatgattcgcctcattactcatgcacttggaggagagggctatct
caacttcatgggcaatgaatttgggcatccagaatggttagacttccccagaaaaggaaa
taacgagagctaccattatgccagaagacagtttcagttagctgatgatcatgttcttcg
ctatagatttctaaatgcttttgacagagatatgaataaattggaagaaagattcggctg
gcttgcatctcccccgggttttgtgagtgaaaaacatgagtctaataaggtcatagcttt
tgagagggcaaatctcatttttatattcaacttccatccgtccaaaagctatgtggacta
cagagtgggtataggaaagcctggatattataaaattgtcctggattctgatgcaccaga
atatggaggccatcaaagactggatcatggcacagaatactttactgaacagtatccaca
taattatcaacctaattcacttttgagagccaattcacagaccagcttcgatggcaagcc
cagaagatgctatctaaaccacctacaggtgtacattccaagcagagtggctattgtact
tcaaaacctggatataccaaactaa

DBGET integrated database retrieval system