KEGG   Alligator sinensis (Chinese alligator): 102387365Help
Entry
102387365         CDS       T02922                                 

Gene name
TGM2
Definition
transglutaminase 2
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 688 aa AA seqDB search
MAEDLVLETCDLQHESNGVTHRTEEMGSQRLVVRRGQPFTIMLHFAGRGYEDGVDTLALN
VQTGPCPTETWGTRSHFPVSSRLQASAWSAAVEQQDGTALSLSLCSPPDARIGLYTLTME
ASTGYQGTSFRLGDFILLFNPWCPEDTVYLEDEDQRTEYVLTQQGIIYQGSNDFIVSAPW
NFGQFEDNMVETCLLLLDTNPKFFRDQNRDCSRRNCPVYIGRVVSAMVNCNDDQGVLAGR
WDNQYSDGVSPMSWIGSVEILRRWSKFGCQPVRYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDTNQNLVIDRYLDERGSLQQGSKDMIWNFHCWVESWMARPDLSAGYDGWQALDPT
PQEKSEGVYCCGPSPVKAIKEGDLVLNYDIPFVFTEVNADLIYWILQSDGSRKKTVHPSI
VGKSISTKGVGRDSREDITHHYKYPEGSDKEREVFAKAKRQKRPVPQEETGMTMRIKVPQ
GANNGCDFDVVAAIHNDTDAERQCRLMFCARVASYNGNVGPECGMKDLLNVTLPPRGDKV
VPLRVLYEKYGHCLTQDNVVKVVALLVEYQTREHIVAMRDIYVKNPDIKIRILGEPKQKR
KLVAEITLTNPLATPLNGCSFTVEGAGLTEGQKIQELDCPVEPGQEAKARVDLMPRQAGL
RKLVVDFESDKLKGVKGFRNVIIAPLPK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatctggtgctggaaacatgcgacctgcagcacgagagcaacggggtgacg
cacaggacggaggagatgggtagccagcggctcgtggtgaggaggggccagcccttcacc
atcatgctgcacttcgcggggcgggggtatgaggacggcgtggacacacttgccctcaac
gtgcaaacaggaccgtgccccacggagacctggggaacccggagccacttccccgtctcc
agccgcctgcaggcgtcggcgtggagcgcggcggtggagcagcaggacggcacggctctc
tccttgtccctctgctccccgcccgacgctcgcatcggcctctacaccctgaccatggag
gcctccaccggctaccaaggcaccagcttccggctgggcgacttcatcctgctcttcaac
ccgtggtgtccagaggacaccgtctatctggaggatgaagaccagcgcaccgagtacgtg
ctgacgcagcagggcatcatctaccagggctcaaacgacttcattgtctccgcaccctgg
aacttcgggcagttcgaggacaacatggtggaaacgtgcctcctgctgctggacacgaac
cccaagttcttccgggaccagaaccgggactgctcccgccgcaactgccccgtctacatc
ggcagggtcgtaagcgccatggtgaactgcaatgatgaccagggggtgctggcagggcgc
tgggacaaccagtacagcgacggggtgagccccatgtcctggataggcagcgtggagatc
ctgcggagatggagcaagttcggctgccagcccgtcagatacggccagtgctgggtcttc
gcggcggtggcctgtacagtcctgaggtgcctggggattcccacacgcgtggtgaccaac
tacaactctgcccacgacaccaaccagaacctggtcatcgaccgctacctggacgaaaga
ggcagcctgcagcaaggatccaaagacatgatatggaacttccactgctgggtggagtcg
tggatggcccgtcccgacctctccgctggctacgacgggtggcaggcgctggaccccact
ccgcaggagaagagcgaaggggtttactgctgcggcccctcgcccgtcaaagccatcaag
gaaggcgacttggtcctgaactacgacatcccattcgtcttcacggaggtcaacgcggac
ctgatctactggatcctgcagagcgatggctcccggaagaagaccgtccacccctccatc
gtggggaagagcatcagcaccaagggcgtgggccgagacagcagggaggacatcacccac
cactacaagtaccccgaaggctccgacaaggaacgggaagtgttcgccaaagccaaacgc
cagaagaggccggtgccccaggaggagacgggcatgaccatgaggatcaaggtgccgcag
ggtgccaacaacggctgcgactttgacgttgtcgccgccatccacaacgacaccgatgcc
gagcggcagtgccgcctcatgttctgcgcccgcgtcgccagctacaacgggaacgtgggt
cccgagtgcggcatgaaggatctgctcaacgtcacgctgccgccccgtggagacaaagtg
gtgccgctgcgtgtcctgtatgagaagtacggccactgcctgacccaggacaacgtggtc
aaagtggtggcactgctggtcgagtaccagacccgggagcacatcgtggccatgcgagac
atctatgtcaagaacccggacatcaagatcaggatactgggggagcccaagcagaagcgg
aagctggtggccgagatcacgctgaccaacccgctggcgacaccgctcaacggctgctcg
ttcaccgtggagggcgccggcctcaccgagggccagaagatccaggagctcgactgcccc
gtggagcccgggcaggaggcgaaggcgcgggtggacctgatgccccgccaggccggcctg
cgcaagctggtggtggatttcgagagcgacaagctgaagggggtgaagggtttccgcaac
gtcatcatcgcccccctgcccaagtga

DBGET integrated database retrieval system