KEGG   Alligator sinensis (Chinese alligator): 102387520Help
Entry
102387520         CDS       T02922                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 738 aa AA seqDB search
MSQPASQKKPPSASLNGRRALPPNFSNAEEDEVPEMEVTGLMPKGFNLKDYLQVVNVNML
SSNQEINKQQHHTDRYYNPKLIVRRGQPYHIQIEFTRPYKPEKDILWLEYIIGRYPQVNK
GTYIQIPLVEELKSGAWGATVMQKEGNSVNLSIMSAPDCIVGKFRLYVAVWTPSGILRTK
RNSATDTYILFNPWCQEDSVFLDDEKEREEYVLNDVGVIFYGDINDIKTRSWNYGQFEEG
LLDACLTIMDRAQLDLSGRSNPVKISRVASAMINARDDEGILAGSWDNIYAYGVPPSAWT
GSVDIILEYHSSASPVRYGQCWVFAGVFNTFLRCLGIPGRIITNYSSAHDNNANLQLDIF
MDEEGIVDHKLTKDSVWNYHCWNEAWMSRPDLPVGFGGWQAVDGTPQETSDGMYRCGPAS
VQAVKHGHVCFQFDAAFVFAEVNSDVVYSKAMKNGTRVIEQIDTTHIGKLIVTKDIGSDG
MKDITEQYKFREGTDEERLALETALMYGIKKEATQDSVHLPQADVDMDFEVENAVLGSDF
KVTITFRNSGHSRHTATAYLSGNIVFYTGVKKNEFKSQSFDVILEPSSSKVEEVLIRSSD
YINQLLDQASLHFFVTARLNETKKILAKQKTSVLDIPKLHLKVQGEKVVGKEMSVTVEFT
NVVKQKLKNVSIRLDGPGILKTALKTFKEIPENSTLTWEEKCIPRRAGLRKLIASLTCDT
LRHVYGELDVEIQKRIAV
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaccagcaagtcagaagaagccaccctctgctagcctgaatgggcgaagagcc
ctcccaccaaacttctccaatgctgaagaagatgaggtccctgaaatggaggtgactggt
ttgatgcctaagggattcaacctgaaagattatttgcaagttgtgaatgttaacatgctt
agcagtaaccaggaaattaataagcagcagcatcatactgatcggtactataaccctaag
ctgattgtgcgtcgtggacaaccttaccatatccagattgaattcacccgtccttacaaa
ccagaaaaggacattctctggttggagtatatcataggtcgatatccacaggtgaacaaa
ggcacttacattcagatccctttggttgaagaactaaaaagcggggcctggggagccacg
gttatgcagaaggagggcaactctgttaacctgtccatcatgtctgcaccagactgcatt
gttgggaaatttcgcctgtatgttgctgtctggaccccctctggcatcctcagaaccaag
agaaactcagcaactgatacctacatcctgttcaatccctggtgccaagaggactctgtg
tttttggatgatgaaaaggaaagggaagagtatgtcctgaatgatgttggcgtgattttc
tatggagacatcaatgatataaaaaccagaagctggaattatggtcagtttgaagagggc
cttctggatgcttgcctgaccattatggacagagcacaactggatctctctgggcggagc
aatccagtcaaaataagtcgagttgcatctgcaatgatcaatgctagagatgacgagggt
atacttgctggctcttgggacaatatttatgcatatggtgttccaccatcagcttggact
ggaagtgtagacattattctggaatatcatagttctgcatccccagtgcgatatggtcag
tgctgggtctttgctggtgtcttcaatacatttttaagatgcttaggtataccaggaaga
atcattaccaattattcctctgcccacgataacaatgccaatttacaactggatatcttc
atggatgaagaaggaatagtggaccacaaactcacaaaagactcagtctggaactatcac
tgctggaatgaggcttggatgtccagacctgatcttcctgttggatttggagggtggcag
gctgtggatggcactcctcaagaaaccagtgatggtatgtatagatgtggtcctgcttca
gtgcaagccgttaaacatggtcatgtttgcttccagtttgacgctgcctttgtttttgct
gaggttaacagtgatgttgtttactccaaagcaatgaaaaatgggacaagagtgattgaa
caaattgacacaacccatattgggaaattaatcgtgaccaaggatattggtagtgatgga
atgaaggatattactgagcagtacaaattccgagaaggtacagatgaagagagactagca
ctcgagactgccctaatgtatggtattaaaaaggaggctacacaggatagtgtgcatctg
ccacaggctgatgttgacatggactttgaagtggaaaatgctgtactcggcagtgacttc
aaagtcaccataactttcagaaacagtggccacagtcgtcacactgcgacagcttacctt
tccggcaatatcgtgttttatacaggagtcaagaagaatgaattcaagagccagtctttt
gatgtgatactggaaccctcttcatcaaaagtggaagaggttttaatcagatcaagcgac
tacatcaatcagctgctggaccaagcctctttgcatttctttgtcacagcacgtctcaat
gaaacaaaaaagattttggccaagcagaagacttcggtcctagacatccccaagctgcac
ctcaaggtgcaaggagaaaaggtagttggtaaagaaatgtctgtgacagtggaattcacc
aatgtagtgaaacaaaagcttaagaatgtgtccatacgtcttgatggacctggaatactg
aagacagccctgaagacattcaaggaaattccagagaattctaccttgacctgggaagaa
aaatgtatccccaggcgagctggacttcgaaagttgattgcaagcctgacttgtgatact
ctgcggcatgtctatggtgagctggatgtagagattcaaaagagaatagctgtgtga

DBGET integrated database retrieval system