KEGG   Alligator sinensis (Chinese alligator): 102388304Help
Entry
102388304         CDS       T02922                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00562  Inositol phosphate metabolism
asn04012  ErbB signaling pathway
asn04068  FoxO signaling pathway
asn04070  Phosphatidylinositol signaling system
asn04140  Autophagy - animal
asn04150  mTOR signaling pathway
asn04210  Apoptosis
asn04218  Cellular senescence
asn04370  VEGF signaling pathway
asn04510  Focal adhesion
asn04620  Toll-like receptor signaling pathway
asn04625  C-type lectin receptor signaling pathway
asn04810  Regulation of actin cytoskeleton
asn04910  Insulin signaling pathway
asn04914  Progesterone-mediated oocyte maturation
asn04933  AGE-RAGE signaling pathway in diabetic complications
Module
asn_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102388304 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102388304 (PIK3CD)
   04370 VEGF signaling pathway
    102388304 (PIK3CD)
   04068 FoxO signaling pathway
    102388304 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102388304 (PIK3CD)
   04150 mTOR signaling pathway
    102388304 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102388304 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    102388304 (PIK3CD)
   04218 Cellular senescence
    102388304 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102388304 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102388304 (PIK3CD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102388304 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102388304 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    102388304 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102388304 (PIK3CD)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102388304 (PIK3CD)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102388304 (PIK3CD)
Membrane trafficking [BR:asn04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102388304 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 102388304
NCBI-ProteinID: XP_006016205
UniProt: A0A1U7RNM5
Position
Un
AA seq 1046 aa AA seqDB search
MLPGIYCPVEFWSKEENQNIQVDFLLPTGIYLSLPVSCNASLGTIKEVVWQHAQYEPLYH
MLNDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSVSDPEVSDFRTKMRQFCEERAAKRQQLSWMAWMEYSFPLQLEPLAKGLGT
SPLHVPHKNIFVNVMFESGGESFTFQISPREYPITLMSYAIKKQATVFRHQTVESPEDYT
LQVNGKCEYLYGNYPLYQFQYIRSCLHQGLMPHLTMVRFSTIIAMRDEQTNCIAHPPKMG
AKPPPLPKKKPNSGSLWSLEQPFYIDLVQGSKVNADERMKLVVQAGLFHGNEMLCKMVSS
SEVNVCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKAGECCLHMWSSFPDEKGELLNPMGTVQSNPNTESAAALVICFPNVSV
HPVHYPAYEQLLDLGRNGEHSRATLDDPEEKQQLKEILERRSHTELYEHEKDLMWKMRYH
IRDQYPEALAKLLIITKWNKHEDVAQMISLLHTWPELPVLNALELLDFSFPDRYVGFFTI
NSLKKLTDEELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHV
PAVALRFGLILEAYCRGSTHHMKVLMKQGEALNKMKALNDFVKVSSQRATKPQTKEMMHV
CMKQETYLEALSNLLSPLNPNIILAEVCVEQCTFMDSKMKPLWIVFNNEETGGGGVGIIF
KNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDKTGLIEVVMHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGEALEQAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRD
YCEKAYMILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRLK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgctcccaggcatttactgccccgtggaattctggtccaaggaggaaaaccaaaacatc
caggtggattttctgctgcccacgggcatttacctgagcctcccggtgtcgtgcaatgct
agcttgggcaccatcaaggaggtggtctggcagcatgcgcagtatgaaccattatatcac
atgctcaatgatcccgaggcctatgtcttcacctgcatcaatcagacggctgagcagcag
gagctggaggatgagcagcggcgtctctgcgacatccagcccttcctgcctgtcttgcgg
ctcgtggcacgagaaggtgaccgggtcaagaagctgattaattcccagatcagcttgctc
attggcaaaggtttgcacgagtttgactcggtgtcggacccagaggtgagcgacttccgc
accaaaatgcgccagttctgcgaggagagggcagcgaagcggcagcagctgagctggatg
gcctggatggagtacagctttcccttgcagctggagcccttggccaaaggcctcgggacc
agccctctgcacgtcccccacaagaacatctttgtcaacgtcatgtttgagtctggcggg
gagagcttcaccttccagatctcccccagggaataccccatcacgttaatgagctacgcc
atcaagaagcaggctaccgttttccgccaccagactgtggagagcccagaggactatacc
ctacaggtgaatggaaaatgtgaatacctctatgggaactaccctctgtaccagttccag
tacatccgcagctgcctgcaccagggcctgatgccccacctgacgatggtgcgcttctcc
accatcattgccatgcgagatgagcagaccaactgcatcgcccatcccccaaagatgggt
gccaagcctcccccactgcccaagaaaaagccaaacagtgggtctctgtggtcccttgag
cagcccttttatattgatctggtgcaaggcagtaaggtcaacgctgatgagaggatgaag
ctggtggtgcaggcaggcctcttccatggcaatgagatgctctgcaagatggtgtcgagc
tctgaggtgaacgtgtgttcagagccagtgtggaagcagcggctggacttcgatattaac
atctgtgacctgccgcgcatggcccggctctgcttcgccctctacgctgtcatcgagaag
gccaagaaggcacgttccaccaagaagaagtccaagaaagcggactgcccaatagcttgg
gtgaatgtcatgctttttgactacaaggaccagctgaaagcaggagaatgctgcctgcat
atgtggtcatcgttcccagatgagaaaggggagctgttgaaccccatgggcacagtccag
agcaacccaaacacagagagtgcagccgccttggttatctgctttcccaatgtctcggtc
catccggtgcactacccagcctatgaacagctgctggatctggggaggaacggagaacac
agccgtgccacactcgacgatccagaggagaagcagcagctgaaggagatcctggagcga
aggagccacactgagctctatgaacatgagaaggatttgatgtggaagatgaggtaccac
atccgggaccagtacccagaggccttggcgaagctcctgatcatcactaagtggaacaaa
cacgaggacgtggcccagatgatctccctgctccacacctggccagagctgcctgtcctg
aacgccttggagctgctggatttcagcttccctgaccgttacgttggtttcttcactatt
aactccttaaaaaagctgacagatgaggagctgttccagtatctgctgcagcttgtccag
gtgctcaagtacgaatcctacttagactgtgaattaaccaagttcctgttggacagagct
ctatctaaccgcaaaatagggcacttcctcttctggcatctcaggtccgaaatgcatgtc
ccagcagtcgctctgaggtttggcttgatcttggaggcctattgcagaggcagcacccac
cacatgaaagttttaatgaaacagggggaagcactcaacaagatgaaagccttgaacgac
tttgtgaaagtgagttctcagagggccaccaagccccagaccaaggagatgatgcatgtg
tgcatgaagcaggagacctacctggaggccctttccaatctcctttctcccctgaaccct
aacattatccttgctgaagtgtgtgtggagcagtgcacattcatggactccaagatgaag
cctttgtggattgtgtttaataacgaggaaacgggcggcggtggcgtgggcatcattttc
aaaaatggagacgatctccgccaggacatgctgacgctacagatgatccagctgatggac
gtgctgtggaagcaggagggcttggacctgaggatgaccccttacggctgcctctccaca
ggcgacaagacggggctgatcgaagtggtcatgcactcggacaccattgccaacatccag
ttgaacaaaagcaacatggcggccaccgctgccttcaacaaggacgcgctgctgaactgg
ctgaaatccaagaacccaggtgaagcactggagcaagcgatcgaggagttcacgctctcc
tgcgctgggtactgtgtggcgacgtatgtcctggggataggagacaggcacagcgacaac
atcatgatccgggaaactggccagctgttccatattgatttcggccattttttggggaac
ttcaaaaccaaatttggtatcaacagagaacgggtcccttttatcctaacctatgacttt
gtgcacgtaatccagcaggggaaaacgaacaacagcgaaaagtttgaaagattcagggat
tactgtgaaaaagcctacatgatcctgaggcgccacggtctcctcttcctgcatttgttt
gcactgatgaaagctgctggcctgccagaactcagctgctctaaagacattcagtatcta
aaggactctctagcactgggaaaaacagatgaggaggcgctgaagcacttcagactaaaa
tttaatgaagcccttcgagagagctggaaaaccaaagtgaactggctggcgcacaatgtc
tccaaagacaacagacagtag

DBGET integrated database retrieval system