KEGG   Archaeoglobus sulfaticallidus: Asulf_00059Help
Entry
Asulf_00059       CDS       T02642                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase-related enzymes
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ast00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Asulf_00059
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Asulf_00059
Enzymes [BR:ast01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Asulf_00059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51709..52203)
Genome map
AA seq 164 aa AA seqDB search
MEGILVKPLKRFADERGFFTEIMREDWNVFQDEVVQANLSITYPGIVRAWHRHERGQVDY
FVCIKGAIKICAYDDETQEPNEIVSTGENLQVVRVPGHYWHGFRAVGSEPAMLVYFVNRL
YDHESPDEIRRPWNDPTVVPRVINGRKDDPRCNKPWDWFYPPHK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatactagtcaagcctttaaaaagatttgcagatgaaagaggattcttcacc
gagataatgcgtgaggactggaatgtattccaggatgaggtagtccaggcaaacctctcc
atcacctacccgggcattgtaagggcatggcacagacatgagaggggacaggttgattac
ttcgtctgcattaagggagccatcaagatatgtgcatacgatgatgaaactcaggagcct
aacgaaatagtttcaacaggcgaaaacctgcaggtggtgagggtgccaggccactactgg
catggctttagagctgttggaagtgaaccagcaatgcttgtttacttcgttaacagactg
tacgatcacgaaagcccagatgaaatcagaagaccttggaacgatcccacagttgtgcct
agggtcataaacggaagaaaagatgatccccgctgcaacaagccctgggactggttctat
ccaccgcataagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system