KEGG   Archaeoglobus sulfaticallidus: Asulf_00194Help
Entry
Asulf_00194       CDS       T02642                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ast  Archaeoglobus sulfaticallidus
Brite
Enzymes [BR:ast01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Asulf_00194
Transfer RNA biogenesis [BR:ast03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Asulf_00194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169538..171130
Genome map
AA seq 530 aa AA seqDB search
MDAHSTYHKACKEIAEELIKASTEPGIELTRSDIEIIKKRIAKKYNLSRIPSNPDIRKFI
PDNERIKKMLRIKPVRTISGVAVVAVMSSPAPCPHGRCVPCPGGIKTPQSYTGREPAAMR
AIQHGYDPFRQVTARLGELKEIGHAVDKVEIIVMGGTFPARDKEYRDHFILNIYNALNSF
DSDPSISSTIEEAKEINEKAKARCIGMTFETRPDYCGLGEIKEMLSYGGTKVELGVQSIY
DDVLEIIKRGHGVDATVKATKLLKNSAFKVGYHIMPGLPSSDFERDLRMFRKIFEDERFK
PDYLKIYPTLVVDGTELYEMYRSGEYRPYTTEEVAELIARAKRFFPKWVRVQRIQRDIPV
KLAIGLDKGNLRQIVHQKLKERGWRCNCIRCREIGHNVGESRVEEILSSCELKIERYRAS
DGVEYFISYETEDFLAGFIRLRFCEAALEEIENHALIRELHVYGISLPLGLKDSSSPQHR
GIGSKLLSAAEEIAIQEFDRIAVISGVGAREYYRKHGYKKLRNYMAKRLK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacacagcacatatcacaaagcctgcaaggagattgctgaagagctcatcaaa
gccagcacagaacctggtatagagctgacaagatccgatatagagatcataaaaaagagg
atagcaaagaagtacaatctatccagaatcccatcgaatccggatatcagaaaattcatt
ccagataacgagagaatcaaaaagatgttgaggataaagcctgttagaacaatctcaggt
gttgccgttgtcgctgtcatgtcatctcctgctccatgcccccatggtaggtgcgttccc
tgtcctggaggtatcaaaaccccgcagagctataccggcagggaacctgcagctatgagg
gccatccagcacggttatgatcctttcaggcaggttactgcaagactgggcgagctgaag
gagataggccatgcggtggataaggttgagattatcgttatgggcggaacatttccggcg
agagataaggaatacagggatcactttatactgaacatttacaacgcccttaacagtttt
gatagcgatccaagtatcagctcaactattgaggaagcaaaggagataaacgagaaggct
aaagcgagatgtatcggaatgaccttcgaaacccgtccggattattgtggtctcggagag
ataaaggagatgctgagctacggtggcacaaaggtggagcttggcgttcagagcatttac
gatgatgttcttgaaatcataaagagggggcatggcgttgatgcaacagttaaagccaca
aagcttctcaagaattcggcttttaaagtcggataccacatcatgcccggattgccttca
agcgactttgaaagagatttgagaatgtttaggaagattttcgaagacgagaggttcaag
ccggattacctcaagatatacccaactctagttgtagatggcactgagctatacgagatg
tacagatctggggagtacagaccatacacaactgaagaggttgccgagcttatagcaagg
gcgaagaggttcttcccgaaatgggtcagggtgcagaggatacagagagatatccctgtc
aagcttgcaataggacttgacaaaggaaatctgaggcagatagtgcatcagaagctgaag
gagagaggctggaggtgcaactgcataagatgcagggagatcggacacaatgttggagag
agtagagtagaagagatcctgtcatcctgtgagctgaaaatagagagatacagggcatca
gatggagtggagtacttcatatcttacgagactgaagactttctggccgggtttataaga
ctgaggttctgtgaggcggcactggaagagatagaaaaccatgcgctcataagagagctc
catgtttacggcatatcccttccacttggcttgaaggattcctcctctccacagcatcgc
ggaattggatcaaagctcttatctgccgcagaggagattgcaatccaggaatttgataga
atagctgtgataagcggtgttggagcaagagaatactacagaaaacatggatacaaaaaa
ttgaggaattatatggcaaaaaggttgaagtaa

DBGET integrated database retrieval system