KEGG   Archaeoglobus sulfaticallidus: Asulf_01018Help
Entry
Asulf_01018       CDS       T02642                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ast00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asulf_01018
Enzymes [BR:ast01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Asulf_01018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(937439..938356)
Genome map
AA seq 305 aa AA seqDB search
MVDMFDVVGFGAINLDKIYRVDKIPGKDEEGFVKDVELHAGGSSANTIAGLARFGLKTAF
IGTVGSDEDGKFLLNDFEREGVDTSLILKQDGRSGNALIFVDDSGNRAILVDPGVNDTIR
YDSISKNFRAKLIHLTSFICKNGIDSFESQKRIVEEGIAEISFDPGLIYVERGLNELEGI
IKKTTIFMPSRNEIELLMNMDYVDAAKEIVSMGCKIVVVKLGKDGCYISDGEKEFCVKAY
RTKPVDTTGAGDAFNAGFIYGYIKGYPLDKCGKIGNFSAMKNIQKVGARAGIPSKKELQE
FLDNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggttgatatgttcgatgttgttggattcggggcgataaacctcgacaagatataccgg
gtggataagataccgggaaaggatgaagaggggtttgtaaaagatgttgagcttcatgct
ggtggtagctctgcaaacacgatagccgggctggcaaggttcggtttgaaaacggcattt
ataggaacagttggcagtgatgaggatggcaagtttctcctcaacgattttgagcgggag
ggagtggacacatctctgatcctgaaacaggatggacggagtggtaatgctctaatcttt
gttgatgactccggaaatagagccattcttgttgatccgggggttaatgatacgataagg
tatgacagcatatcaaaaaatttcagggccaagcttatacatctgacatcttttatctgt
aagaacggtattgattcttttgaaagtcagaagagaattgttgaggaaggtatagctgaa
atatcttttgatcccgggcttatatatgttgagagaggtttgaatgagcttgaagggata
ataaagaagacaaccatattcatgccgagcagaaatgaaatagagcttctgatgaacatg
gactatgttgatgcagccaaggagatagtttcgatgggctgcaagatcgttgttgttaaa
ctgggcaaagatggctgttatatcagcgatggtgagaaggagttctgtgtgaaggcttac
agaacgaagccggttgatactactggagcgggagatgcgttcaatgcgggctttatctac
ggatacatcaagggctaccccctagataaatgtggtaaaattggaaacttttcagcgatg
aaaaatatccagaaggttggagctagagcgggaatacccagtaagaaagagttgcaggag
tttctagataatctgtga

DBGET integrated database retrieval system