KEGG   Archaeoglobus sulfaticallidus: Asulf_01568Help
Entry
Asulf_01568       CDS       T02642                                 

Definition
DNA polymerase LigD, ligase domain protein
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ast03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ast03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ast03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:ast03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1403743..1404738
Genome map
AA seq 331 aa AA seqDB search
MAAKDQITKDWFYKNIDPMLAVKGKPFSSSDYLYEIKWDGTRCIAFVDVDENRLRLQNRR
FLDIKYRYPEFRFHEQFSKSVVLDGEIVVLHNGRSDFRLLQKREQIENRAKIRILSSMYP
AVYVVFDILWDGEWIMDLPLIERKKILSELTDTAENLMISDYILGEGTEFYKKAIELGFE
GIMAKKLESPYILGRSDYWIKIKRKNTIDAVIIGYMSGEGVREQHFGSLLLGLYDGSDLI
YIGRVGTGFDSEFLEYFAKRIKKLVVDRLSIKNFEEIEMVRRDVGLIKPYYVAEVEFLEV
TNELKLRAPVFKRLRLDKDPKDCRIDQLRDG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaagaccagatcacaaaggactggttctataaaaatatagatccaatgctg
gcagttaagggaaaaccattcagcagttctgactatctgtatgagatcaagtgggatgga
acgagatgcatagcgtttgtggatgttgatgaaaaccgcctcaggctgcagaacaggaga
tttctggatataaaatacagatatcctgagttcagatttcacgaacagttttcaaagagt
gttgttctggatggtgaaatagttgtactgcataacggcaggtcggacttcagactcctc
caaaagagggagcaaattgagaacagagcgaagatcaggattctttccagcatgtatcct
gcagtatatgtggtcttcgacattctgtgggatggggaatggattatggatcttccgctg
atagagcgaaagaagatcctgtctgaacttacagatacagcggaaaatctaatgatttcg
gactacattcttggagaagggactgaattttacaaaaaagcaatcgaactcggctttgag
ggcataatggcgaaaaagcttgagagtccgtatatcttggggagaagtgattactggatc
aagattaaaaggaagaataccatagatgcggtgatcataggttatatgagtggtgagggc
gtgagagagcagcattttggctccctgcttctcggtctatatgatgggagtgacctgatc
tacataggcagggttggaacgggattcgattccgagttcttggaatattttgctaagaga
ataaaaaagctggttgttgataggcttagcatcaaaaacttcgaggagatcgaaatggta
aggagggatgtgggactcatcaaaccatactatgtcgccgaagttgaatttctggaagtt
acgaatgaactcaagttaagggctccggttttcaaaaggttaaggctggataaggatccg
aaggattgtagaatagatcagcttagggatggttga

DBGET integrated database retrieval system