KEGG   Archaeoglobus sulfaticallidus: Asulf_01957Help
Entry
Asulf_01957       CDS       T02642                                 

Definition
(GenBank) Sugar kinase, ribokinase family
Organism
ast  Archaeoglobus sulfaticallidus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1766675..1767559
Genome map
AA seq 294 aa AA seqDB search
MIAGFGPALVDYTHLIDKYPPAGGHAIVRKTERFAGGAAGNVIFGLSKLGLRCRFYTTLG
EDDDSRFYLSEMRSAGVEVVYTISHRYAGKCDIYVDPSGERTFFVHPNSAGIINLDVSSE
DFKEIDYVYLDPFPAEMSFEFHLSVAKKARKENCCVMINPGFPYISLGFKRLKELLKYCD
IVFMSRDELEAIDASTGDFLEYVEILVVTMGKEGSSAYTRDKRFFERAFEVKTVDTTGAG
DAFAAGFIYAYTKGYDLEKCLKTGNYVASVNVQKVGARNFPDRTELDKFLKITD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattgccggattcgggcctgctctcgtggattacactcacctgatcgacaaatacccc
cctgctggagggcatgcgatagtcagaaaaacagagaggtttgccggaggagctgccggg
aatgttatcttcggactttcaaaactcggattgaggtgcagattttacacaacactggga
gaggatgatgattccagattctacctcagcgagatgagaagtgctggagttgaggttgtt
tacaccatctctcaccgatatgctggaaagtgcgatatatatgttgatcccagtggtgag
agaacctttttcgtgcatcccaactctgcgggaattatcaacctcgatgtaagctctgaa
gactttaaagagatcgattatgtttatctagatccttttcctgctgagatgagctttgaa
ttccatctgagcgttgcaaaaaaggccaggaaggagaattgctgtgttatgatcaatcct
ggatttccctatatttctctgggattcaagaggttgaaggagttattgaaatattgtgat
atcgtcttcatgtccagagatgagcttgaagccatagacgccagcacaggggactttcta
gaatatgtcgagattctggttgttacgatgggaaaggaaggaagttcagcctacactaga
gacaaaagattttttgagagagcgtttgaagttaagacagtagacacaaccggagcagga
gatgcttttgcagctggctttatctacgcatatacaaagggatatgatttagagaaatgt
ctgaaaaccggaaactatgttgcatcggttaatgtccagaaggtgggtgcaagaaacttt
ccagacagaacagagcttgataagtttctgaaaataactgattga

DBGET integrated database retrieval system