KEGG   Archaeoglobus sulfaticallidus: Asulf_01985Help
Entry
Asulf_01985       CDS       T02642                                 

Definition
Ribulose-5-phosphate 4-epimerase-related epimerase and aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ast00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Asulf_01985
Enzymes [BR:ast01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Asulf_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1797220..1797786
Genome map
AA seq 188 aa AA seqDB search
MFEEAVFEEAALYGRKLYERGLIDGASGNLSFKDGDYVFITKTGVNLYDLTKESFVKVRI
DADAEKLKALSASSDALLHIKAYQKSDYSVILHCHGTYNVVLSLIYDKIVPVDLEGKLFL
GEIEVIDASFMTEEYAEMVSDGIAKKGFAVVKGHGIYCAGKTFREVFNVIEYIEHSCQVL
YLARLVGL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaagaagctgtgtttgaagaggcagcactgtatggcaggaagctgtatgaaagg
ggattgatagatggtgcgagtggaaacctgagctttaaagacggcgattatgttttcata
accaagacaggggttaacttatatgatttaaccaaagaatcgtttgttaaggtaagaatt
gatgctgatgcagagaagctaaaggcactttcagcatcatctgatgctctacttcacata
aaagcgtatcaaaagagcgattacagtgttattctgcactgtcatgggacttacaatgtt
gttctatcgctgatttatgataagatagttcctgttgatctggaaggaaagctgtttctt
ggtgagattgaggttatagatgccagtttcatgacagaagagtatgctgaaatggtctca
gatgggattgcgaagaaagggtttgctgtggtcaaggggcacgggatatactgtgcggga
aaaactttcagagaggtgtttaatgttattgagtacatagagcattcgtgtcaggtgttg
tatctggctagactggtgggtctgtga

DBGET integrated database retrieval system