KEGG   Archaeoglobus sulfaticallidus: Asulf_02183Help
Entry
Asulf_02183       CDS       T02642                                 

Definition
(GenBank) Alcohol dehydrogenase, class IV
Organism
ast  Archaeoglobus sulfaticallidus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1978858..1980000)
Genome map
AA seq 380 aa AA seqDB search
MWWFASPKIAFGEDSLDFLETLDGKAMIVTDENLVKSGVVDKVTKRLNLEYEVFDKVEPD
PSFEIVMEGVEFAKRVKPDYIIGVGGGSSLDTAKGIRLIYENPDLDPEEVSPWTDVKSGE
VKLILIPTASGSGSEGSNAIVLTKKDEGRKIASIHPAVMADYAIVDPEMVRELPEKVAVF
TGLDALSHAMDAYVSAWKNDFTDGLCIQACKLLFKYLPRACRDRSDSEAVEKVHNAATLA
GLAIGSSQAGLSHSIGHSLGAVFHIPHGFACGVALPYTTQYYSKFVREQYDELAYHIGFR
DCEELIDKTKELLASLNTPLSYKDLLEEYGISEKEFLERLDELVYKASTDNTIVTLEEAP
DEEDLRMLFLYIFEGKDVDF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtttgcatcaccaaaaatagcatttggagaagattctctcgacttccttgaa
accctcgatggtaaagctatgatagttacagacgaaaacctggtcaaatccggggttgtt
gacaaggttacaaagaggttgaaccttgagtacgaggtattcgataaagttgaaccagat
ccatcgtttgaaatcgtcatggagggagttgagttcgcgaaaagagtaaagccggattac
atcatcggtgttggagggggctcatccctcgatactgctaagggaatcaggctcatatac
gagaatcccgatctcgatcctgaggaggtctctccgtggactgatgttaaaagtggagag
gttaagctgattctaatccctacagcgagtggtagcgggagtgaaggatccaatgccata
gtcctgaccaagaaggatgagggcaggaaaatagcatccatccatccggcggttatggcc
gattatgcaatagttgatccggagatggtcagggagctgcctgagaaggtggcggtgttc
acaggcttggatgcactctcccatgctatggatgcttatgtctctgcatggaagaatgat
ttcaccgatggcttatgcatccaggcctgcaagctactcttcaaatacctaccaagggct
tgcagggatagaagcgacagtgaggctgtggagaaggttcacaatgctgcaaccctcgct
ggactggcgataggtagctctcaggctggtttatcgcactctatcggccactctcttggg
gcggtatttcatatccctcatggcttcgcctgtggtgttgcattgccttatacaacgcag
tactactcgaagttcgtgagagagcagtatgacgagcttgcataccatattggcttcagg
gattgtgaggagctgatcgacaaaacaaaggagttgctcgcatccctgaacactccactc
agctacaaggatctgctggaggagtatggcataagcgaaaaagaattccttgaaaggctt
gatgaactggtttacaaagccagcacggacaacacaattgttacgctggaggaagctcca
gatgaggaagatctcaggatgctattcctttacatcttcgaaggaaaggatgttgatttt
tga

DBGET integrated database retrieval system