KEGG   Archaeoglobus sulfaticallidus: Asulf_02183Help
Entry
Asulf_02183       CDS       T02642                                 

Definition
Alcohol dehydrogenase, class IV
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ast00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Asulf_02183
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asulf_02183
   00620 Pyruvate metabolism
    Asulf_02183
   00650 Butanoate metabolism
    Asulf_02183
  Lipid metabolism
   00071 Fatty acid degradation
    Asulf_02183
  Amino acid metabolism
   00350 Tyrosine metabolism
    Asulf_02183
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Asulf_02183
   00626 Naphthalene degradation
    Asulf_02183
Enzymes [BR:ast01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Asulf_02183
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Asulf_02183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1978858..1980000)
Genome map
AA seq 380 aa AA seqDB search
MWWFASPKIAFGEDSLDFLETLDGKAMIVTDENLVKSGVVDKVTKRLNLEYEVFDKVEPD
PSFEIVMEGVEFAKRVKPDYIIGVGGGSSLDTAKGIRLIYENPDLDPEEVSPWTDVKSGE
VKLILIPTASGSGSEGSNAIVLTKKDEGRKIASIHPAVMADYAIVDPEMVRELPEKVAVF
TGLDALSHAMDAYVSAWKNDFTDGLCIQACKLLFKYLPRACRDRSDSEAVEKVHNAATLA
GLAIGSSQAGLSHSIGHSLGAVFHIPHGFACGVALPYTTQYYSKFVREQYDELAYHIGFR
DCEELIDKTKELLASLNTPLSYKDLLEEYGISEKEFLERLDELVYKASTDNTIVTLEEAP
DEEDLRMLFLYIFEGKDVDF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtttgcatcaccaaaaatagcatttggagaagattctctcgacttccttgaa
accctcgatggtaaagctatgatagttacagacgaaaacctggtcaaatccggggttgtt
gacaaggttacaaagaggttgaaccttgagtacgaggtattcgataaagttgaaccagat
ccatcgtttgaaatcgtcatggagggagttgagttcgcgaaaagagtaaagccggattac
atcatcggtgttggagggggctcatccctcgatactgctaagggaatcaggctcatatac
gagaatcccgatctcgatcctgaggaggtctctccgtggactgatgttaaaagtggagag
gttaagctgattctaatccctacagcgagtggtagcgggagtgaaggatccaatgccata
gtcctgaccaagaaggatgagggcaggaaaatagcatccatccatccggcggttatggcc
gattatgcaatagttgatccggagatggtcagggagctgcctgagaaggtggcggtgttc
acaggcttggatgcactctcccatgctatggatgcttatgtctctgcatggaagaatgat
ttcaccgatggcttatgcatccaggcctgcaagctactcttcaaatacctaccaagggct
tgcagggatagaagcgacagtgaggctgtggagaaggttcacaatgctgcaaccctcgct
ggactggcgataggtagctctcaggctggtttatcgcactctatcggccactctcttggg
gcggtatttcatatccctcatggcttcgcctgtggtgttgcattgccttatacaacgcag
tactactcgaagttcgtgagagagcagtatgacgagcttgcataccatattggcttcagg
gattgtgaggagctgatcgacaaaacaaaggagttgctcgcatccctgaacactccactc
agctacaaggatctgctggaggagtatggcataagcgaaaaagaattccttgaaaggctt
gatgaactggtttacaaagccagcacggacaacacaattgttacgctggaggaagctcca
gatgaggaagatctcaggatgctattcctttacatcttcgaaggaaaggatgttgatttt
tga

DBGET integrated database retrieval system