KEGG   Actinobacillus succinogenes: Asuc_0016Help
Entry
Asuc_0016         CDS       T00558                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
asu  Actinobacillus succinogenes
Pathway
asu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:asu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Asuc_0016
Enzymes [BR:asu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Asuc_0016
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Asuc_0016
DNA repair and recombination proteins [BR:asu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Asuc_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Zn_Tnp_IS1595 FbpA DUF4428 Ribosomal_S13
Motif
Other DBs
NCBI-ProteinID: ABR73398
UniProt: A6VKA1
Position
14157..14969
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETAKNGITPYLDGFYIEKIIVRQPKLRWEVSPELSQISHQKVTALSRRAKYLI
IHTAQGYIIGHLGMSGAVRIVSPDSPVNKHDHLDIVMNNGKIMRYNDPRRFGAWFWTENL
DEFPLFAKLGPEPLSGEFNSDYLFKKSRKKPTAVKSFIMNNAVVVGIGNIYANEVLFQCG
LHPEKPAGKITKTQAALLTETIKKELTRAIAQGGTTLKDFLQPDGKPGYFVQELQIYGKK
GCPCPKCGQKIESFTVGQRNSYVCLHCQKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattacctgaagtcgaaacggccaaaaacggcataacgccttatctggacggt
ttttacattgaaaaaattatcgtgcgccaaccgaaactgcgctgggaagtcagccctgaa
ctctctcaaatttctcatcaaaaagtgaccgcactttcccgccgcgccaaatatctgatt
atccatactgcacaaggttatatcatcggtcatctcggtatgtcgggagccgtccgcatt
gtgtcgccggactcgccggtcaataaacacgatcatctggacattgtgatgaataacggc
aaaatcatgcgttataacgatccccgccgtttcggcgcatggttttggactgaaaatctt
gatgaatttccgctgtttgccaaattaggtcccgaaccgctttccggtgagttcaacagt
gattatttattcaaaaaatcacgtaaaaaaccgaccgcagttaaatccttcattatgaat
aatgccgtggtggtgggaatcggtaacatttatgccaacgaagtgctgtttcaatgcggt
ttacatccggaaaaaccggcgggcaaaattaccaaaacccaggcggcattgttaacggaa
accattaaaaaagaattaacccgagccatcgcccaaggcggtacgacattaaaggacttt
ttgcaacccgacggaaaacccggctattttgtgcaggaattacaaatttacggaaaaaaa
ggctgtccctgcccgaagtgcggtcaaaaaatcgaaagttttactgtaggacagcgcaac
agctatgtttgtcttcactgccagaaaaaataa

DBGET integrated database retrieval system