KEGG   Actinobacillus succinogenes: Asuc_0049Help
Entry
Asuc_0049         CDS       T00558                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asu  Actinobacillus succinogenes
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Asuc_0049
   00052 Galactose metabolism
    Asuc_0049
   00500 Starch and sucrose metabolism
    Asuc_0049
   00520 Amino sugar and nucleotide sugar metabolism
    Asuc_0049
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Asuc_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(61897..62784)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVSECVAAGIKEIVLVTHSSKNAI
ENHFDTSYELESMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVVLPDVLLADFTADQKRENLAAMIKRFEETGASQIMVAPVEPKDVSSYGVADCNGV
EFGGGESAQISRLVEKPSVDKAPSNLAVVGRYVFSAGIWELLERTPVGVGDEIQLTDAID
MLIKKETVEAFHMTGESFDCGDKIGYMEAFVEYGLQHEKLGTQFKDYLKKLVKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattattccagttgcaggcctgggaacacgtatgttgccggcaaccaaagcc
attccgaaggagatgctgacactggtggataaaccgttaattcagtatgtggtcagtgaa
tgtgtcgcagccgggattaaagaaattgttttggttacgcattcgtcaaaaaatgctatc
gaaaaccattttgatacgtcttacgaattggaatctatgctggaaaaacgggttaaacgc
caacttttagaagaagtacgttcaatttgtccgaaagacgttactattatgcatgtacgc
caagggaatgctaaaggtttaggacatgccgtattatgcggtcgtcctttagtcggaaac
gaaccttttgccgttgttttacctgacgtattattggcggattttaccgctgatcagaaa
agagaaaatctggcggcgatgatcaagcgttttgaagaaacgggagccagtcagattatg
gtagcgccggtggagccgaaagatgtcagcagttatggcgtggcggactgtaacggtgtt
gaatttggcggaggcgaaagtgctcagatttcccgtttggtggaaaaaccgagtgtcgat
aaagcgccgtctaatttagccgtcgtggggcgctatgtattctcagccggtatttgggaa
ctattggaaagaactccggtcggtgtgggagatgaaatccagttaaccgatgccatcgat
atgttaattaaaaaagaaacggtggaggctttccacatgaccggtgaatcttttgactgc
ggtgataaaatcggttacatggaagcctttgtcgaatacggtttgcagcatgaaaaatta
ggtacccaatttaaagattacctgaaaaaattggtcaaaaccctataa

DBGET integrated database retrieval system