KEGG   Actinobacillus succinogenes: Asuc_0049Help
Entry
Asuc_0049         CDS       T00558                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asu  Actinobacillus succinogenes
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Asuc_0049
   00052 Galactose metabolism
    Asuc_0049
   00500 Starch and sucrose metabolism
    Asuc_0049
   00520 Amino sugar and nucleotide sugar metabolism
    Asuc_0049
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Asuc_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(61897..62784)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVSECVAAGIKEIVLVTHSSKNAI
ENHFDTSYELESMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVVLPDVLLADFTADQKRENLAAMIKRFEETGASQIMVAPVEPKDVSSYGVADCNGV
EFGGGESAQISRLVEKPSVDKAPSNLAVVGRYVFSAGIWELLERTPVGVGDEIQLTDAID
MLIKKETVEAFHMTGESFDCGDKIGYMEAFVEYGLQHEKLGTQFKDYLKKLVKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattattccagttgcaggcctgggaacacgtatgttgccggcaaccaaagcc
attccgaaggagatgctgacactggtggataaaccgttaattcagtatgtggtcagtgaa
tgtgtcgcagccgggattaaagaaattgttttggttacgcattcgtcaaaaaatgctatc
gaaaaccattttgatacgtcttacgaattggaatctatgctggaaaaacgggttaaacgc
caacttttagaagaagtacgttcaatttgtccgaaagacgttactattatgcatgtacgc
caagggaatgctaaaggtttaggacatgccgtattatgcggtcgtcctttagtcggaaac
gaaccttttgccgttgttttacctgacgtattattggcggattttaccgctgatcagaaa
agagaaaatctggcggcgatgatcaagcgttttgaagaaacgggagccagtcagattatg
gtagcgccggtggagccgaaagatgtcagcagttatggcgtggcggactgtaacggtgtt
gaatttggcggaggcgaaagtgctcagatttcccgtttggtggaaaaaccgagtgtcgat
aaagcgccgtctaatttagccgtcgtggggcgctatgtattctcagccggtatttgggaa
ctattggaaagaactccggtcggtgtgggagatgaaatccagttaaccgatgccatcgat
atgttaattaaaaaagaaacggtggaggctttccacatgaccggtgaatcttttgactgc
ggtgataaaatcggttacatggaagcctttgtcgaatacggtttgcagcatgaaaaatta
ggtacccaatttaaagattacctgaaaaaattggtcaaaaccctataa

DBGET integrated database retrieval system